Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Frizzled-7-A (fzd7-a) Recombinant Protein | fzd7-a recombinant protein

Recombinant Xenopus laevis Frizzled-7-A (fzd7-a)

Gene Names
fzd7; fz7; Fz-7; Xfz7; frz7; frz-7; fzd7-a; fzd7-b; frizzled7; frizzled-7
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Frizzled-7-A (fzd7-a); Recombinant Xenopus laevis Frizzled-7-A (fzd7-a); fzd7-a recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
23-549aa; full length protein
Sequence
YHGEKGISVPDHGFCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQC SPELRFFLCSMYAPVCTVLEQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVH GAGEICVGQNTSDNSPSGPTARPSPYLPDSITFQPHPHRDFTCPRQLKVPPYLAYRFLGE KDCGAPCEPGKANGLMYFKEEEVRFARLWVGIWAILCCISTLFTVLTYLVDMRRFSYPER PIIFLSGCYFMVAVAYTAGFLLEERAVCVERFSEDSYRTVAQGTKKEGCTILFMILYFFG MASSIWWVILSLTWFLSAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQVDGDVL SGVCYVGINSVDSLRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKL MVRIGVFSVMYTVPATIVLACYFYEQAFRDTWEKTWLVQTCKGYAVPCPNYNFAPMSPDF TVFMIKYLMTMIVGITSSFWIWSGKTLQSWRRFYHRLSNGSKGETAV
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Xenopus laevis (African clawed frog)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for fzd7-a recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
62,119 Da
NCBI Official Full Name
frizzled class receptor 7
NCBI Official Synonym Full Names
frizzled class receptor 7
NCBI Official Symbol
fzd7
NCBI Official Synonym Symbols
fz7; Fz-7; Xfz7; frz7; frz-7; fzd7-a; fzd7-b; frizzled7; frizzled-7
NCBI Protein Information
frizzled class receptor 7
UniProt Protein Name
Frizzled-7-A
Protein Family
UniProt Gene Name
fzd7-a
UniProt Synonym Gene Names
fz7-a; Fz-7-A; Xfz7-A
UniProt Entry Name
FZD7A_XENLA

Uniprot Description

Receptor for Wnt proteins. Acts in both canonical and non-canonical Wnt pathways. Although different papers report differing Wnt preferences, wnt5a, wnt8b and wnt11 have been proposed as synergists. In the canonical Wnt pathway, acts via beta-catenin to promote the expression of the dorsal genes siamois, twin and nodal3 and to establish the dorsal axis of the embryo and induce dorsal mesoderm formation. In a non-canonical Wnt/planar cell polarity (PCP) pathway, acts with sdc4 and dvl2/dsh to regulate convergent extension cell movements during gastrulation. Triggers phosphorylation of dvl2/dsh and its translocation to the plasma membrane. In a third branch of Wnt signaling, acts in a non-canonical pathway via trimeric G proteins, and independently of dvl2/dsh, to recruit protein kinase C (PKC) to the membrane and thus activate PKC. PKC signaling controls cell sorting and tissue separation during gastrulation.

Research Articles on fzd7-a

Similar Products

Product Notes

The fzd7-a fzd7-a (Catalog #AAA7015420) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-549aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the fzd7-a fzd7-a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: YHGEKGISVP DHGFCQPISI PLCTDIAYNQ TIMPNLLGHT NQEDAGLEVH QFYPLVKVQC SPELRFFLCS MYAPVCTVLE QAIPPCRSLC ERARQGCEAL MNKFGFQWPE RLRCENFPVH GAGEICVGQN TSDNSPSGPT ARPSPYLPDS ITFQPHPHRD FTCPRQLKVP PYLAYRFLGE KDCGAPCEPG KANGLMYFKE EEVRFARLWV GIWAILCCIS TLFTVLTYLV DMRRFSYPER PIIFLSGCYF MVAVAYTAGF LLEERAVCVE RFSEDSYRTV AQGTKKEGCT ILFMILYFFG MASSIWWVIL SLTWFLSAGM KWGHEAIEAN SQYFHLAAWA VPAVKTITIL AMGQVDGDVL SGVCYVGINS VDSLRGFVLA PLFVYLFIGT SFLLAGFVSL FRIRTIMKHD GTKTEKLEKL MVRIGVFSVM YTVPATIVLA CYFYEQAFRD TWEKTWLVQT CKGYAVPCPN YNFAPMSPDF TVFMIKYLMT MIVGITSSFW IWSGKTLQSW RRFYHRLSNG SKGETAV. It is sometimes possible for the material contained within the vial of "Frizzled-7-A (fzd7-a), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.