Frizzled-4 (Fzd4) Recombinant Protein | Fzd4 recombinant protein

Recombinant Mouse Frizzled-4 (Fzd4)

Cat. Num. AAA7015405

• Gene Names: Fzd4; Fz4
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Frizzled-4 (Fzd4); Recombinant Mouse Frizzled-4 (Fzd4); Fzd4 recombinant protein

• Host: Cell Free Expression
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 37-537aa; full length protein
• Sequence: FGDEEERRCDPIRIAMCQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQF FLCSVYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLREFGFAWPDTLNCSKFPPQNDHNH MCMEGPGDEEVPLPHKTPIQPGEECHSVGSNSDQYIWVKRSLNCVLKCGYDAGLYSRSAK EFTDIWMAVWASLCFISTTFTVLTFLIDSSRFSYPERPIIFLSMCYNIYSIAYIVRLTVG RERISCDFEEAAEPVLIQEGLKNTGCAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWG HEAIEMHSSYFHIAAWAIPAVKTIVILIMRLVDADELTGLCYVGNQNLDALTGFVVAPLF TYLVIGTLFIAAGLVALFKIRSNLQKDGTKTDKLERLMVKIGVFSVLYTVPATCVIACYF YEISNWALFRYSADDSNMAVEMLKIFMSLLVGITSGMWIWSAKTLHTWQKCSNRLVNSGK VKREKRGNGWVKPGKGNETVV
• Sequence Length: Full length protein

• Application Notes: This is a recombinant transmembrane protein expressed in a cell-free expression system.
• Species: Mouse
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.; Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.

Product Categories/Family for Fzd4 recombinant protein

Transmembrane Protein

NCBI and Uniprot Product Information

• NCBI GI #: 188035913
• NCBI GeneID: 14366
• NCBI Accession #: NP_032081.3
• NCBI GenBank Nucleotide #: NM_008055.4
• UniProt Accession #: Q61088
• Molecular Weight: 60,143 Da
• NCBI Official Full Name: frizzled-4
• NCBI Official Synonym Full Names: frizzled class receptor 4
• NCBI Official Symbol: Fzd4
• NCBI Official Synonym Symbols: Fz4
• NCBI Protein Information: frizzled-4
• UniProt Protein Name: Frizzled-4
• UniProt Gene Name: Fzd4
• UniProt Synonym Gene Names: Fz-4; mFz4
• UniProt Entry Name: FZD4_MOUSE

Uniprot Description

FZD4: Receptor for Wnt proteins. Most of frizzled receptors are coupled to the beta-catenin (CTNNB1) canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin (CTNNB1) and activation of Wnt target genes. Plays a critical role in retinal vascularization by acting as a receptor for Wnt proteins and norrin (NDP). In retina, it can be both activated by Wnt protein-binding, but also by a Wnt-independent signaling via binding of norrin (NDP), promoting in both cases beta-catenin (CTNNB1) accumulation and stimulation of LEF/TCF-mediated transcriptional programs. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues. Defects in FZD4 are the cause of vitreoretinopathy exudative type 1 (EVR1); also known as autosomal dominant familial exudative vitreoretinopathy (FEVR) or Criswick- Schepens syndrome. EVR1 is a disorder of the retinal vasculature characterized by an abrupt cessation of growth of peripheral capillaries, leading to an avascular peripheral retina. This may lead to compensatory retinal neovascularization, which is thought to be induced by hypoxia from the initial avascular insult. New vessels are prone to leakage and rupture causing exudates and bleeding, followed by scarring, retinal detachment and blindness. Clinical features can be highly variable, even within the same family. Patients with mild forms of the disease are asymptomatic, and their only disease-related abnormality is an arc of avascular retina in the extreme temporal periphery. Belongs to the G-protein coupled receptor Fz/Smo family.

Protein type: GPCR, Fz/Smo family; Receptor, GPCR; Membrane protein, integral; Membrane protein, multi-pass

Cellular Component: cell surface; integral to membrane; intercellular junction; membrane; plasma membrane

Molecular Function: cytokine binding; G-protein coupled receptor activity; PDZ domain binding; protein binding; protein heterodimerization activity; protein homodimerization activity; signal transducer activity; transmembrane receptor activity; ubiquitin protein ligase binding; Wnt receptor activity; Wnt-protein binding

Biological Process: blood vessel development; cell surface receptor linked signal transduction; G-protein coupled receptor protein signaling pathway; locomotion during locomotory behavior; luteinization; multicellular organismal development; positive regulation of JNK activity; positive regulation of transcription factor activity; positive regulation of transcription, DNA-dependent; progesterone secretion; regulation of vascular endothelial growth factor receptor signaling pathway; sensory perception of sound; signal transduction; vasculogenesis; Wnt receptor signaling pathway; Wnt receptor signaling pathway through beta-catenin; Wnt receptor signaling pathway, calcium modulating pathway