Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Frizzled-3 (fzd3) Recombinant Protein | fzd3 recombinant protein

Recombinant Xenopus laevis Frizzled-3 (fzd3)

Gene Names
fzd3; fz3; frz3; frz-3; frizzled3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Frizzled-3 (fzd3); Recombinant Xenopus laevis Frizzled-3 (fzd3); fzd3 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
17-664aa; full length protein
Sequence
QKSMGHSLFACEPITLRMCQDLPYNSTFMPNLLNHYDQQTAALAMEPFHPMVNLECSRDL RPFLCALYTPVCMEYGRMTLPCRKLCQRAYNECFKLMEMFGVPWPEEMECSRFPDCDEPY PRIVDISLSGEPSEETPLAVQRDYGFWCPRELKIDPDLRSSFLGVRDCSPPCPHMYFRRE ELSFARYFIGVISIVCLSATLFTFLTFLIDVTRFRYPERPIIFYAVCYMMVSLIFFIGFL LEDKVACNGANPSQYKASTVTQGSHNKACTMLFMVLYFFTMAGSVWWVILTITWFLAAVP KWGSEAIEKKALLFHASAWGIPGTLTIILLAMNKIEGDNISGVCFVGLYDVHALRYFVLA PLCLDVVVGVSLLLAGIISLNRVRIEIPLEKENQDKLVKFMIRIGVFSILYLVPLLVVIG CYFYEQAYRGVWETTWVQERCREYHIPCPYKVTQTSRPDLILFLMKYLMLLVVGIPSVFW VGSKKTCFEWASFFHGRKKKAGVNESRQVLQEPDFAQSLLRDPNTPIVRKSRGTSTQGTS THASSTQLAMLDDQRSKAGSVQSKVSSYHGSLHRSRDGRYTPCSYRGIEERLPHGSMSHL TDHSRHSSTHRLNEQSHQGSIRDLSNPLAHISHGTSMNRVIEADATSA
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Xenopus laevis (African clawed frog)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for fzd3 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
75,619 Da
NCBI Official Full Name
frizzled-3
NCBI Official Synonym Full Names
frizzled class receptor 3
NCBI Official Symbol
fzd3
NCBI Official Synonym Symbols
fz3; frz3; frz-3; frizzled3
NCBI Protein Information
frizzled-3
UniProt Protein Name
Frizzled-3
UniProt Gene Name
fzd3
UniProt Synonym Gene Names
fz3; Fz-3; Xfz3
UniProt Entry Name
FZD3_XENLA

Uniprot Description

Receptor for Wnt proteins. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. Activated by Wnt8. Involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues. Plays a role in controlling early axon growth and guidance processes necessary for the formation of a subset of central and peripheral major fiber tracts. Involved in the migration of cranial neural crest cells. May also be implicated in the transmission of sensory information from the trunk and limbs to the brain. Controls commissural sensory axons guidance after midline crossing along the anterior-posterior axis in the developing spinal cord in a Wnt-dependent signaling pathway. Together with FZD6, is involved in the neural tube closure and plays a role in the regulation of the establishment of planar cell polarity (PCP). Promotes neurogenesis by maintaining sympathetic neuroblasts within the cell cycle in a beta-catenin-dependent manner ().

Similar Products

Product Notes

The fzd3 fzd3 (Catalog #AAA7015402) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 17-664aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the fzd3 fzd3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: QKSMGHSLFA CEPITLRMCQ DLPYNSTFMP NLLNHYDQQT AALAMEPFHP MVNLECSRDL RPFLCALYTP VCMEYGRMTL PCRKLCQRAY NECFKLMEMF GVPWPEEMEC SRFPDCDEPY PRIVDISLSG EPSEETPLAV QRDYGFWCPR ELKIDPDLRS SFLGVRDCSP PCPHMYFRRE ELSFARYFIG VISIVCLSAT LFTFLTFLID VTRFRYPERP IIFYAVCYMM VSLIFFIGFL LEDKVACNGA NPSQYKASTV TQGSHNKACT MLFMVLYFFT MAGSVWWVIL TITWFLAAVP KWGSEAIEKK ALLFHASAWG IPGTLTIILL AMNKIEGDNI SGVCFVGLYD VHALRYFVLA PLCLDVVVGV SLLLAGIISL NRVRIEIPLE KENQDKLVKF MIRIGVFSIL YLVPLLVVIG CYFYEQAYRG VWETTWVQER CREYHIPCPY KVTQTSRPDL ILFLMKYLML LVVGIPSVFW VGSKKTCFEW ASFFHGRKKK AGVNESRQVL QEPDFAQSLL RDPNTPIVRK SRGTSTQGTS THASSTQLAM LDDQRSKAGS VQSKVSSYHG SLHRSRDGRY TPCSYRGIEE RLPHGSMSHL TDHSRHSSTH RLNEQSHQGS IRDLSNPLAH ISHGTSMNRV IEADATSA. It is sometimes possible for the material contained within the vial of "Frizzled-3 (fzd3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.