Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Frizzled-4 (fz4) Recombinant Protein | fz4 recombinant protein

Recombinant Drosophila melanogaster Frizzled-4 (fz4)

Gene Names
fz4; anon-WO0170980.10; anon-WO0170980.11; CG4626; Dfz4; DFz4; Dm Fz4; DmelCG4626; Fz4
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Frizzled-4 (fz4); Recombinant Drosophila melanogaster Frizzled-4 (fz4); fz4 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
23-705aa; full length protein
Sequence
STSGNPSASSSSSSPPEIPAFRQCETIRIEMCRKIGYNETSMPNLVGNEMQTDVEYTLQT FAPLIEYDCSSQLKLFLCAAYVPMCTPKAPVHAIGPCRSLCESVRIRCHPVLQGFGFPWP PALDCDKFPRENNHETMCMEGPGELHQPQQEQDLYGLPGQGIPGGLGGKLPMDCSGLAKS HLYVRLPRSGRCAPLCEADILFTPAEKHLAEIWVSTWAYAALGLALVATVCLLASDGSRL ASAKWSRLLSPLIWCHNMVTLGWAVRFMVGRTGTACGTDPQAPNESLLTVDGLSNASCAS VFLMRYYFGMAACAWWAVLCLGWHRDIRRHSPDSKGHVVIPSNFGGSPAKRNSAKTAQQD LTQNNFVCFVAWGLPAFQTSAVIVARFVDADELLGACFVGNQSDKALQILVATPVFCYWI FGSMNLISGYLVHCRTKEILRNSNALSVQQQLQQLSAHSSSGIGIFLFIYGLACAMLLLA VIYEFANIDVWLGSGDTNTPLWPFLLRAFMELMLGICCFAWVLGPSISTLYKRQVSNGKM VKHTSAGAATGHLDGHSSSRGSHAACNSTVVSYHSVRTSMASVPLPPSPYKLKTSPGTGS ISLNQMSNYSLGRSVHHQQRHSPHHHHHQQQQHHQFHPHHNHQHHSTSSHRLYYPPGSYA SQKYSQHGSYYPHLQQYGNETLL
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Drosophila melanogaster (Fruit fly)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for fz4 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
77,490 Da
NCBI Official Full Name
frizzled 4, isoform A
NCBI Official Synonym Full Names
frizzled 4
NCBI Official Symbol
fz4
NCBI Official Synonym Symbols
anon-WO0170980.10; anon-WO0170980.11; CG4626; Dfz4; DFz4; Dm Fz4; DmelCG4626; Fz4
NCBI Protein Information
CG4626 gene product from transcript CG4626-RB
UniProt Protein Name
Frizzled-4
Protein Family
UniProt Gene Name
fz4
UniProt Synonym Gene Names
dFz4
UniProt Entry Name
FRIZ4_DROME

Uniprot Description

Receptor for Wnt proteins. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues. Required to coordinate the cytoskeletons of epidermal cells to produce a parallel array of cuticular hairs and bristles.

Research Articles on fz4

Similar Products

Product Notes

The fz4 fz4 (Catalog #AAA7015386) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-705aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the fz4 fz4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: STSGNPSASS SSSSPPEIPA FRQCETIRIE MCRKIGYNET SMPNLVGNEM QTDVEYTLQT FAPLIEYDCS SQLKLFLCAA YVPMCTPKAP VHAIGPCRSL CESVRIRCHP VLQGFGFPWP PALDCDKFPR ENNHETMCME GPGELHQPQQ EQDLYGLPGQ GIPGGLGGKL PMDCSGLAKS HLYVRLPRSG RCAPLCEADI LFTPAEKHLA EIWVSTWAYA ALGLALVATV CLLASDGSRL ASAKWSRLLS PLIWCHNMVT LGWAVRFMVG RTGTACGTDP QAPNESLLTV DGLSNASCAS VFLMRYYFGM AACAWWAVLC LGWHRDIRRH SPDSKGHVVI PSNFGGSPAK RNSAKTAQQD LTQNNFVCFV AWGLPAFQTS AVIVARFVDA DELLGACFVG NQSDKALQIL VATPVFCYWI FGSMNLISGY LVHCRTKEIL RNSNALSVQQ QLQQLSAHSS SGIGIFLFIY GLACAMLLLA VIYEFANIDV WLGSGDTNTP LWPFLLRAFM ELMLGICCFA WVLGPSISTL YKRQVSNGKM VKHTSAGAAT GHLDGHSSSR GSHAACNSTV VSYHSVRTSM ASVPLPPSPY KLKTSPGTGS ISLNQMSNYS LGRSVHHQQR HSPHHHHHQQ QQHHQFHPHH NHQHHSTSSH RLYYPPGSYA SQKYSQHGSY YPHLQQYGNE TLL. It is sometimes possible for the material contained within the vial of "Frizzled-4 (fz4), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.