Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Disulfide bond formation protein B (dsbB) Recombinant Protein | dsbB recombinant protein

Recombinant Cupriavidus necator Disulfide bond formation protein B (dsbB)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Disulfide bond formation protein B (dsbB); Recombinant Cupriavidus necator Disulfide bond formation protein B (dsbB); dsbB recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-161aa; full length protein
Sequence
MQANSRAYFLLIALVSFGLVGVALYLQFEKGYQPCPLCVMQRFAFIGIGIFSLLAAVAQN TRSLWQGLGMLSGIAGIAVAVYHVSLLLNPKASCGIDPLENWVNALPTAKALPQVFYADG LCTAPLPPVLGLSVPAWSLIWLFILTLTLAVGLIRREKNFR
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) (Ralstonia eutropha)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for dsbB recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17,437 Da
NCBI Official Full Name
MULTISPECIES: disulfide bond formation protein B
NCBI Official Symbol
H16_RS10535
NCBI Protein Information
disulfide bond formation protein B
UniProt Protein Name
Disulfide bond formation protein B
UniProt Gene Name
dsbB
UniProt Entry Name
DSBB_CUPNH

Uniprot Description

Required for disulfide bond formation in some periplasmic proteins. Acts by oxidizing the DsbA protein.

Similar Products

Product Notes

The dsbB dsbb (Catalog #AAA7013942) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-161aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the dsbB dsbb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MQANSRAYFL LIALVSFGLV GVALYLQFEK GYQPCPLCVM QRFAFIGIGI FSLLAAVAQN TRSLWQGLGM LSGIAGIAVA VYHVSLLLNP KASCGIDPLE NWVNALPTAK ALPQVFYADG LCTAPLPPVL GLSVPAWSLI WLFILTLTLA VGLIRREKNF R. It is sometimes possible for the material contained within the vial of "Disulfide bond formation protein B (dsbB), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.