Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Cytochrome c oxidase assembly protein COX15 homolog (Cox15) Recombinant Protein | Cox15 recombinant protein

Recombinant Mouse Cytochrome c oxidase assembly protein COX15 homolog (Cox15)

Gene Names
Cox15; 2900026G05Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cytochrome c oxidase assembly protein COX15 homolog (Cox15); Recombinant Mouse Cytochrome c oxidase assembly protein COX15 homolog (Cox15); Cox15 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-413aa; full length protein
Sequence
MQRLLLPSLRALTGSRNVGLLVPRVASRTQCGSSCGSQRPLRPGQYSTITEVALQSGKGT VSLPSRAAERAVGRWLLVCSGTVAGAVILGGVTRLTESGLSMVDWHLIKEMKPPTSQEEW EAEFQKYQQFPEFKILNHDMTLAEFKFIWYMEYSHRMWGRAVGLAYILPAAYFWRKGWLN RGMKGRVLALCGLVCFQGLLGWYMVKSGLEEKPESYDIPRVSQYRLAAHLGSALVLYCAS LWTSLSLLLPQHKLPETRQLLWLRRFAGGTAGLVFLTALSGAFVAGLDAGLVYNSFPKMG ESWIPEDLLTFSPVLKNVFENPTMVQFDHRLLGVTSVTAITVLYFLSRRIPLPRRTKMAA VTLLALAYAQVALGISTLLMYVPTPLAATHQSGSLALLSGALWLMNELRRVPK
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Cox15 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44,006 Da
NCBI Official Full Name
cytochrome c oxidase assembly protein COX15 homolog
NCBI Official Synonym Full Names
cytochrome c oxidase assembly protein 15
NCBI Official Symbol
Cox15
NCBI Official Synonym Symbols
2900026G05Rik
NCBI Protein Information
cytochrome c oxidase assembly protein COX15 homolog
UniProt Protein Name
Cytochrome c oxidase assembly protein COX15 homolog
UniProt Gene Name
Cox15
UniProt Entry Name
COX15_MOUSE

Uniprot Description

COX15: May be involved in the biosynthesis of heme A. Defects in COX15 are a cause of mitochondrial complex IV deficiency (MT-C4D); also known as cytochrome c oxidase deficiency. A disorder of the mitochondrial respiratory chain with heterogeneous clinical manifestations, ranging from isolated myopathy to severe multisystem disease affecting several tissues and organs. Features include hypertrophic cardiomyopathy, hepatomegaly and liver dysfunction, hypotonia, muscle weakness, excercise intolerance, developmental delay, delayed motor development and mental retardation. A subset of patients manifest Leigh syndrome. Defects in COX15 are a cause of Leigh syndrome (LS). An early-onset progressive neurodegenerative disorder characterized by the presence of focal, bilateral lesions in one or more areas of the central nervous system including the brainstem, thalamus, basal ganglia, cerebellum and spinal cord. Clinical features depend on which areas of the central nervous system are involved and include subacute onset of psychomotor retardation, hypotonia, ataxia, weakness, vision loss, eye movement abnormalities, seizures, and dysphagia. Belongs to the COX15/CtaA family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; Membrane protein, integral; Energy Metabolism - oxidative phosphorylation; Cofactor and Vitamin Metabolism - porphyrin and chlorophyll; Mitochondrial

Cellular Component: integral to membrane; membrane; mitochondrial inner membrane; mitochondrion

Molecular Function: cytochrome-c oxidase activity; oxidoreductase activity, acting on NADH or NADPH, heme protein as acceptor; oxidoreductase activity, acting on the CH-CH group of donors

Biological Process: heme a biosynthetic process; respiratory chain complex IV assembly

Similar Products

Product Notes

The Cox15 cox15 (Catalog #AAA7012390) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-413aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Cox15 cox15 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MQRLLLPSLR ALTGSRNVGL LVPRVASRTQ CGSSCGSQRP LRPGQYSTIT EVALQSGKGT VSLPSRAAER AVGRWLLVCS GTVAGAVILG GVTRLTESGL SMVDWHLIKE MKPPTSQEEW EAEFQKYQQF PEFKILNHDM TLAEFKFIWY MEYSHRMWGR AVGLAYILPA AYFWRKGWLN RGMKGRVLAL CGLVCFQGLL GWYMVKSGLE EKPESYDIPR VSQYRLAAHL GSALVLYCAS LWTSLSLLLP QHKLPETRQL LWLRRFAGGT AGLVFLTALS GAFVAGLDAG LVYNSFPKMG ESWIPEDLLT FSPVLKNVFE NPTMVQFDHR LLGVTSVTAI TVLYFLSRRI PLPRRTKMAA VTLLALAYAQ VALGISTLLM YVPTPLAATH QSGSLALLSG ALWLMNELRR VPK. It is sometimes possible for the material contained within the vial of "Cytochrome c oxidase assembly protein COX15 homolog (Cox15), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.