Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Complement component C9 (C9) Recombinant Protein | C9 recombinant protein

Recombinant Rat Complement component C9 (C9)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Complement component C9 (C9); Recombinant Rat Complement component C9 (C9); C9 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
21-554aa; full length protein
Sequence
QAPEPTPREEPSADALLPIDCRMSTWSQWSQCDPCLKQRFRSRSIEVFGQFQGKSCADAL GDRQHCEPTQECEEVQENCGNDFQCETGRCIKRKLLCNGDNDCGDFSDESDCESDPRLPC RDRVVEESELGRTAGYGINILGMDPLGTPFDNEFYNGLCDRVRDGNTLTYYRKPWNVAFL AYETKADKNFRTENYEEQFEMFKTIVRDRTTSFNANLALKFTITEAPIKKVGVDEVSPEK NSSKPKDSSVDFQFSYFKKENFQRLSSYLSQTKKMFLHVKGMIQLGRFVMRNRGVMLTTT FLDDVKALPVSYEKGEYFGFLETYGTHYSSSGSLGGLYELIYVLDKASMKEKGVELSDVK RCLGFNLDVSLYTPLQTALEGPSLTANVNHSDCLKTGDGKVVNISRDHIIDDVISFIRGG TRKQAVLLKEKLLRGAKTIDVNDFINWASSLDDAPALISQKLSPIYNLIPLTMKDAYAKK QNMEKAIEDYVNEFSARKCYPCQNGGTAILLDGQCMCSCTIKFKGIACEISKQR
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Rat
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for C9 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
62,281 Da
NCBI Official Full Name
complement component C9
NCBI Official Synonym Full Names
complement component 9
NCBI Official Symbol
C9
NCBI Protein Information
complement component C9
UniProt Protein Name
Complement component C9
Protein Family
UniProt Gene Name
C9
UniProt Entry Name
CO9_RAT

NCBI Description

component of the terminal complement complex C5b-9, which induces cleavage and activation of caspase 3 and mediates induction of apoptosis [RGD, Feb 2006]

Uniprot Description

C9: Constituent of the membrane attack complex (MAC) that plays a key role in the innate and adaptive immune response by forming pores in the plasma membrane of target cells. C9 is the pore-forming subunit of the MAC. Defects in C9 are a cause of complement component 9 deficiency (C9D). A rare defect of the complement classical pathway associated with susceptibility to severe recurrent infections, predominantly by Neisseria gonorrhoeae or Neisseria meningitidis. Belongs to the complement C6/C7/C8/C9 family.

Protein type: Membrane protein, multi-pass; Membrane protein, integral; Extracellular matrix; Apoptosis

Cellular Component: cytoplasm; extracellular region; membrane attack complex; plasma membrane

Biological Process: blood coagulation; complement activation, alternative pathway; complement activation, classical pathway; cytolysis; immune response

Research Articles on C9

Similar Products

Product Notes

The C9 c9 (Catalog #AAA7010617) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 21-554aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the C9 c9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: QAPEPTPREE PSADALLPID CRMSTWSQWS QCDPCLKQRF RSRSIEVFGQ FQGKSCADAL GDRQHCEPTQ ECEEVQENCG NDFQCETGRC IKRKLLCNGD NDCGDFSDES DCESDPRLPC RDRVVEESEL GRTAGYGINI LGMDPLGTPF DNEFYNGLCD RVRDGNTLTY YRKPWNVAFL AYETKADKNF RTENYEEQFE MFKTIVRDRT TSFNANLALK FTITEAPIKK VGVDEVSPEK NSSKPKDSSV DFQFSYFKKE NFQRLSSYLS QTKKMFLHVK GMIQLGRFVM RNRGVMLTTT FLDDVKALPV SYEKGEYFGF LETYGTHYSS SGSLGGLYEL IYVLDKASMK EKGVELSDVK RCLGFNLDVS LYTPLQTALE GPSLTANVNH SDCLKTGDGK VVNISRDHII DDVISFIRGG TRKQAVLLKE KLLRGAKTID VNDFINWASS LDDAPALISQ KLSPIYNLIP LTMKDAYAKK QNMEKAIEDY VNEFSARKCY PCQNGGTAIL LDGQCMCSCT IKFKGIACEI SKQR. It is sometimes possible for the material contained within the vial of "Complement component C9 (C9), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.