Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

BCL2/adenovirus E1B 19 kDa protein-interacting protein 3 (BNIP3) Recombinant Protein | BNIP3 recombinant protein

Recombinant Human BCL2/adenovirus E1B 19 kDa protein-interacting protein 3 (BNIP3)

Gene Names
BNIP3; NIP3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
BCL2/adenovirus E1B 19 kDa protein-interacting protein 3 (BNIP3); Recombinant Human BCL2/adenovirus E1B 19 kDa protein-interacting protein 3 (BNIP3); BNIP3 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-194aa; full length protein
Sequence
MSQNGAPGMQEESLQGSWVELHFSNNGNGGSVPASVSIYNGDMEKILLDAQHESGRSSSK SSHCDSPPRSQTPQDTNRASETDTHSIGEKNSSQSEEDDIERRKEVESILKKNSDWIWDW SSRPENIPPKEFLFKHPKRTATLSMRNTSVMKKGGIFSAEFLKVFLPSLLLSHLLAIGLG IYIGRRLTTSTSTF
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Human
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for BNIP3 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
664
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21,541 Da
NCBI Official Full Name
BCL2/adenovirus E1B 19 kDa protein-interacting protein 3
NCBI Official Synonym Full Names
BCL2/adenovirus E1B 19kDa interacting protein 3
NCBI Official Symbol
BNIP3
NCBI Official Synonym Symbols
NIP3
NCBI Protein Information
BCL2/adenovirus E1B 19 kDa protein-interacting protein 3
UniProt Protein Name
BCL2/adenovirus E1B 19 kDa protein-interacting protein 3
UniProt Gene Name
BNIP3
UniProt Synonym Gene Names
NIP3
UniProt Entry Name
BNIP3_HUMAN

NCBI Description

This gene is encodes a mitochondrial protein that contains a BH3 domain and acts as a pro-apoptotic factor. The encoded protein interacts with anti-apoptotic proteins, including the E1B 19 kDa protein and Bcl2. This gene is silenced in tumors by DNA methylation. [provided by RefSeq, Dec 2014]

Uniprot Description

BNIP3: Apoptosis-inducing protein that, which can overcome BCL2 suppression. May play a role in repartitioning calcium between the two major intracellular calcium stores in association with BCL2. Homodimer. Binds to BCL2. Interacts with BNIP3L and ACAA2. Also can interact with adenovirus E1B 19 kDa protein or Epstein-Barr virus BHRF1. Belongs to the NIP3 family.

Protein type: Membrane protein, integral; Mitochondrial

Chromosomal Location of Human Ortholog: 10q26.3

Cellular Component: cytoplasm; dendrite; endoplasmic reticulum; integral to mitochondrial outer membrane; mitochondrial membrane; mitochondrial outer membrane; mitochondrion; nuclear envelope; nucleoplasm; nucleus

Molecular Function: GTPase binding; identical protein binding; protein binding; protein heterodimerization activity; protein homodimerization activity

Biological Process: apoptosis; autophagic cell death; brown fat cell differentiation; cell death; defense response to virus; induction of apoptosis by granzyme; mitochondrial fragmentation during apoptosis; mitochondrion degradation; negative regulation of apoptosis; negative regulation of membrane potential; neuron apoptosis; positive regulation of apoptosis; positive regulation of autophagy; positive regulation of macroautophagy; positive regulation of programmed cell death; positive regulation of protein complex disassembly; regulation of mitochondrial membrane permeability; response to hyperoxia; response to hypoxia; viral reproduction

Research Articles on BNIP3

Similar Products

Product Notes

The BNIP3 bnip3 (Catalog #AAA7010438) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-194aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the BNIP3 bnip3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSQNGAPGMQ EESLQGSWVE LHFSNNGNGG SVPASVSIYN GDMEKILLDA QHESGRSSSK SSHCDSPPRS QTPQDTNRAS ETDTHSIGEK NSSQSEEDDI ERRKEVESIL KKNSDWIWDW SSRPENIPPK EFLFKHPKRT ATLSMRNTSV MKKGGIFSAE FLKVFLPSLL LSHLLAIGLG IYIGRRLTTS TSTF. It is sometimes possible for the material contained within the vial of "BCL2/adenovirus E1B 19 kDa protein-interacting protein 3 (BNIP3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.