Bifunctional protein aas (aas) Recombinant Protein | aas recombinant protein
Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Bifunctional protein aas (aas)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Bifunctional protein aas (aas); Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B Bifunctional protein aas (aas); aas recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-718aa; full length protein
Sequence
MAYRLLRALFRGLFRVTIDGITDQFSHQKLIITPNHVSFLDGALLALFLPIKPVFAVYSN ITESWYMRWLKPYVDFVALDPTKPMAIKHLVRMVEQGRPVVIFPEGRITVTGSLMKIYDG AAFVAAKSGAAVVPIRLEGPEFTRFGRLGDVLKVRWFPKISIHVLPATTLPMPQAPRARD RRVLAGERLHAIMMAARMAIVPRETLFEALLSAQTRYGRFKPCIEDISFKEDSYQTLLKK ILGVSRILQRFTAQGEHVGMLLPNATITAAAIFGATLRGRIPALLNYTSGAKGLKSAITA ASLKTIITSRQFLEKGKLTHLPEQVTEANWVYLEDLKDTVTLADKLWILFHLCCPRRAMV PQQADDSALILFTSGSEGNPKGVVHSHASLLANVEQIRTIADFTPRDRFMSSLPLFHAFG LTVGLFTPLMTGSRVFLYPSPLHYRVVPELVYDRNCTVLFGTSTFLGNYARFAHPYDFAR LRYVVAGAEKLADSTKQIWQDKFGIRILEGYGVTECAPVVAINVPMAAKVNTVGRILPGM ESRVIPVPGIEQGGRLQLRGPNIMRGYLRVEKPGVLEQPSAENTQGEQEAGWYDTGDIVA IDEQGFCTIRGRMKRFAKLAGEMVSLESVEQLVLRISPEGQHAAATKTDSAKGEALVLFT TDSEITREKLVKAARESGVPELAVPRDIRVVKALPLLGSGKPDFVTLSKMAEDPEMSA
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Yersinia enterocolitica serotype O:8 / biotype 1B (strain 8081)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for aas recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
79,473 Da
NCBI Official Full Name
bifunctional 2-acylglycerophosphoethanolamine acyltransferase/acyl-ACP synthetase
NCBI Official Symbol
aas
NCBI Protein Information
bifunctional acyl-[acyl carrier protein] synthetase/2-acylglycerophosphoethanolamine acyltransferase
UniProt Protein Name
Bifunctional protein Aas
Protein Family
UniProt Gene Name
aas
UniProt Entry Name
AAS_YERE8
Uniprot Description
Plays a role in lysophospholipid acylation. Transfers fatty acids to the 1-position via an enzyme-bound acyl-ACP intermediate in the presence of ATP and magnesium. Its physiological function is to regenerate phosphatidylethanolamine from 2-acyl-glycero-3-phosphoethanolamine (2-acyl-GPE) formed by transacylation reactions or degradation by phospholipase A1.
Similar Products
Product Notes
The aas aas (Catalog #AAA7007088) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-718aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the aas aas for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAYRLLRALF RGLFRVTIDG ITDQFSHQKL IITPNHVSFL DGALLALFLP IKPVFAVYSN ITESWYMRWL KPYVDFVALD PTKPMAIKHL VRMVEQGRPV VIFPEGRITV TGSLMKIYDG AAFVAAKSGA AVVPIRLEGP EFTRFGRLGD VLKVRWFPKI SIHVLPATTL PMPQAPRARD RRVLAGERLH AIMMAARMAI VPRETLFEAL LSAQTRYGRF KPCIEDISFK EDSYQTLLKK ILGVSRILQR FTAQGEHVGM LLPNATITAA AIFGATLRGR IPALLNYTSG AKGLKSAITA ASLKTIITSR QFLEKGKLTH LPEQVTEANW VYLEDLKDTV TLADKLWILF HLCCPRRAMV PQQADDSALI LFTSGSEGNP KGVVHSHASL LANVEQIRTI ADFTPRDRFM SSLPLFHAFG LTVGLFTPLM TGSRVFLYPS PLHYRVVPEL VYDRNCTVLF GTSTFLGNYA RFAHPYDFAR LRYVVAGAEK LADSTKQIWQ DKFGIRILEG YGVTECAPVV AINVPMAAKV NTVGRILPGM ESRVIPVPGI EQGGRLQLRG PNIMRGYLRV EKPGVLEQPS AENTQGEQEA GWYDTGDIVA IDEQGFCTIR GRMKRFAKLA GEMVSLESVE QLVLRISPEG QHAAATKTDS AKGEALVLFT TDSEITREKL VKAARESGVP ELAVPRDIRV VKALPLLGSG KPDFVTLSKM AEDPEMSA. It is sometimes possible for the material contained within the vial of "Bifunctional protein aas (aas), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
