E3 ubiquitin-protein ligase MARCH11 (MARCH11) Recombinant Protein | MARCH11 recombinant protein
Recombinant Rat E3 ubiquitin-protein ligase MARCH11 (MARCH11)
Gene Names
March11; MARCH-XI; RGD1559945
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
E3 ubiquitin-protein ligase MARCH11 (MARCH11); Recombinant Rat E3 ubiquitin-protein ligase MARCH11 (MARCH11); MARCH11 recombinant protein
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-398aa; Full length protein
Sequence
MSDEGSKRGSRADSLEAEPPLPPPPPPPPPGESSLVPTSPRYRPPLPAPLERIVGSGEPP VELAPRRKGEPLPPLPPSRLPGDQEVSAAGDSCEGPRRLPEVKLPEAAAGKGSPAEPEAG ACREGERRGTGDQPETRSVYSSRSSSSGGSGDQRSGHQHQHHQPICKICFQGAEQGELLN PCRCDGSVRYTHQLCLLKWISERGSWTCELCCYRYHVTAIKMKQPCQWQSISITLVEKVQ MIAVILGSLFLIASVTWLLWSAFSPYAVWQRKDILFQICYGMYGFMDLVCIGLIVHEGAA VYRVFKRWRAVNLHWDVLNYDKATDIEESSRGESSTSRTLWLPLSALRNRNLVHPTQLTS PRFQCGYVLLHLFNRMRAHEDVSEDNGSGEVVMRVTSV
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Rat
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for MARCH11 recombinant protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44,085 Da
NCBI Official Full Name
E3 ubiquitin-protein ligase MARCH11
NCBI Official Synonym Full Names
membrane associated ring-CH-type finger 11
NCBI Official Symbol
March11
NCBI Official Synonym Symbols
MARCH-XI; RGD1559945
NCBI Protein Information
E3 ubiquitin-protein ligase MARCH11
UniProt Protein Name
E3 ubiquitin-protein ligase MARCH11
UniProt Gene Name
March11
UniProt Synonym Gene Names
MARCH-XI
UniProt Entry Name
MARHB_RAT
Uniprot Description
MARCH11: E3 ubiquitin-protein ligase that mediates polyubiquitination of CD4. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates. May play a role in ubuquitin-dependent protein sorting in developmenting spermatids. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, multi-pass; EC 6.3.2.-; Ligase; EC 6.3.2.19; Ubiquitin ligase; Membrane protein, integral; Ubiquitin conjugating system; Vesicle
Cellular Component: cytoplasmic vesicle membrane; integral to membrane
Molecular Function: ligase activity; zinc ion binding
Biological Process: protein ubiquitination
Research Articles on MARCH11
Similar Products
Product Notes
The MARCH11 march11 (Catalog #AAA7006893) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-398aa; Full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the MARCH11 march11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSDEGSKRGS RADSLEAEPP LPPPPPPPPP GESSLVPTSP RYRPPLPAPL ERIVGSGEPP VELAPRRKGE PLPPLPPSRL PGDQEVSAAG DSCEGPRRLP EVKLPEAAAG KGSPAEPEAG ACREGERRGT GDQPETRSVY SSRSSSSGGS GDQRSGHQHQ HHQPICKICF QGAEQGELLN PCRCDGSVRY THQLCLLKWI SERGSWTCEL CCYRYHVTAI KMKQPCQWQS ISITLVEKVQ MIAVILGSLF LIASVTWLLW SAFSPYAVWQ RKDILFQICY GMYGFMDLVC IGLIVHEGAA VYRVFKRWRA VNLHWDVLNY DKATDIEESS RGESSTSRTL WLPLSALRNR NLVHPTQLTS PRFQCGYVLL HLFNRMRAHE DVSEDNGSGE VVMRVTSV. It is sometimes possible for the material contained within the vial of "E3 ubiquitin-protein ligase MARCH11 (MARCH11), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
