Testing Data
(Fig-1: Detection of mouse CD73 in the CHO-K1/mCD73 stable cell line by Flow Cytometry [Cell surface staining]. CHO-K1 cells (Green); CHO-K1/mCD73 cells (Red).)
mCD73 cell line
mCD73 Stable Cell Line
Gene Names
Nt5e; NT; Nt5; eNT; CD73; 5'-NT; AI447961; 2210401F01Rik
Applications
Functional Assay, Flow Cytometry, Functional Assay, Immunocytochemistry, Western Blot
Synonyms
mCD73; mCD73 Stable Cell Line; Cell Lines; Stable Cell Lines; CD73; ecto-5'-nucleotidase; Functional Assay; 14-513ACL; 14-517; mCD73 cell line
Form/Format
Each vial contains 2 ~ 3 x 10^6 cells in 1 ml of 90% FBS + 10% DMSO.
Sequence
MRPAAAKVPKWLLLALSALLPQWPAASAWELTILHTNDVHSRLEQTSDDSTKCLNASLCV GGVARLFTKVQQIRKEEPNVLFLDAGDQYQGTIWFTVYKGLEVAHFMNILGYDAMALGNH EFDNGVEGLIDPLLRNVKFPILSANIKARGPLAHQISGLFLPSKVLSVGGEVVGIVGYTS KETPFLSNPGTNLVFEDEISALQPEVDKLKTLNVNKIIALGHSGFEMDKLIAQKVRGVDI VVGGHSNTFLYTGNPPSKEVPAGKYPFIVTADDGRQVPVVQAYAFGKYLGYLKVEFDDKG NVITSYGNPILLNSSIPEDATIKADINQWRIKLDNYSTQELGRTIVYLDGSTQTCRFREC NMGNLICDAMINNNLRHPDEMFWNHVSMCIVNGGGIRSPIDEKNNGTITWENLAAVLPFG GTFDLVQLKGSTLKKAFEHSVHRYGQSTGEFLQVGGIHVVYDINRKPWNRVVQLEVLCTK CRVPIYEPLEMDKVYKVTLPSYLANGGDGFQMIKDELLKHDSGDQDISVVSEYISKMKVV YPAVEGRIKFSAASHYQGSFPLVILSFWAMILILYQ
Sequence Length
3580
Applicable Applications for mCD73 cell line
Functional Assay, Flow Cytometry (FC/FACS), Immunocytochemistry (ICC), Western Blot (WB)
Application Notes
Culture conditions: Cells should be grown at 37 degree C with 5% CO2 using DMEM medium (w/ L-Glutamine, 4.5g/L Glucose and Sodium Pyruvate) supplemented with 10% heat-inactivated FBS supplemented with 10% FBS and 1% Pen/Strep, plus 10 ug/ml of Blasticidin. It is recommended to quickly thaw the frozen cells upon receipt or from liquid nitrogen in a 37 degree C water-bath, transfer to a tube containing 10 ml of growth medium without Blasticidin, spin down cells, resuspend cells in pre-warmed growth medium without Blasticidin, transfer resuspended cells to T25 flask and culture in 37 degree C -CO2 incubator. Leave the T25 flask in the incubator for 1~2 days without disturbing or changing the medium until cells completely recover viability and become adherent. Once cells are over 90% adherent, remove growth medium and passage the cells through trypsinization and centrifugation. At first passage, switch to growth medium containing Blasticidin. Cells should be split before they reach complete confluence. To passage the cells, detach cells from culture vessel with Trypsin/EDTA, add complete growth medium and transfer to a tube, spin down cells, resuspend cells and seed appropriate aliquots of cells suspension into new culture vessels. Subcultivation ration = 1:10 to 1:20 weekly. To achieve satisfactory results, cells should not be passaged over 16 times.
Shipping Note
Product available only in the USA.
Dry Ice Shipment
Extra charge fee may add to your shipping cost as dry ice is required to ship this product.
Preparation and Storage
Immediately upon receipt, store in liquid nitrogen.
Testing Data
(Fig-1: Detection of mouse CD73 in the CHO-K1/mCD73 stable cell line by Flow Cytometry [Cell surface staining]. CHO-K1 cells (Green); CHO-K1/mCD73 cells (Red).)
Testing Data
(Fig-1: Detection of mouse CD73 in the CHO-K1/mCD73 stable cell line by Flow Cytometry [Cell surface staining]. CHO-K1 cells (Green); CHO-K1/mCD73 cells (Red).)
Related Product Information for mCD73 cell line
mCD73 Stable Cell Line is a stably transfected CHO-K1 cell line which expresses mouse Cluster of Differentiation 73 (CD73 also known as ecto-5'-nucleotidase).
Product Categories/Family for mCD73 cell line
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Mus musculus 5' nucleotidase, ecto (Nt5e), mRNA
NCBI Official Synonym Full Names
5' nucleotidase, ecto
NCBI Official Symbol
Nt5e
NCBI Official Synonym Symbols
NT; Nt5; eNT; CD73; 5'-NT; AI447961; 2210401F01Rik
NCBI Protein Information
5'-nucleotidase
UniProt Protein Name
5'-nucleotidase
UniProt Gene Name
Nt5e
UniProt Synonym Gene Names
Nt5; Nte; 5'-NT
NCBI Description
This gene encodes a membrane-bound nucleotidase that hydrolyzes extracellular nucleoside monophosphates. The encoded preproprotein undergoes proteolytic processing to generate to a functional, homodimeric enzyme that preferentially uses adenosine monophosphate as a substrate to generate free adenosine. Mice lacking the encoded protein exhibit a significantly reduced fall in stop flow pressure and superficial nephron glomerular filtration rate in response to a saturating increase of tubular perfusion flow. [provided by RefSeq, Sep 2016]
Uniprot Description
Hydrolyzes extracellular nucleotides into membrane permeable nucleosides.
Research Articles on mCD73
Similar Products
Product Notes
The mCD73 nt5e (Catalog #AAA669351) is a Cell Line and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's mCD73 can be used in a range of immunoassay formats including, but not limited to, Functional Assay, Flow Cytometry (FC/FACS), Immunocytochemistry (ICC), Western Blot (WB). Culture conditions: Cells should be grown at 37 degree C with 5% CO2 using DMEM medium (w/ L-Glutamine, 4.5g/L Glucose and Sodium Pyruvate) supplemented with 10% heat-inactivated FBS supplemented with 10% FBS and 1% Pen/Strep, plus 10 ug/ml of Blasticidin. It is recommended to quickly thaw the frozen cells upon receipt or from liquid nitrogen in a 37 degree C water-bath, transfer to a tube containing 10 ml of growth medium without Blasticidin, spin down cells, resuspend cells in pre-warmed growth medium without Blasticidin, transfer resuspended cells to T25 flask and culture in 37 degree C -CO2 incubator. Leave the T25 flask in the incubator for 1~2 days without disturbing or changing the medium until cells completely recover viability and become adherent. Once cells are over 90% adherent, remove growth medium and passage the cells through trypsinization and centrifugation. At first passage, switch to growth medium containing Blasticidin. Cells should be split before they reach complete confluence. To passage the cells, detach cells from culture vessel with Trypsin/EDTA, add complete growth medium and transfer to a tube, spin down cells, resuspend cells and seed appropriate aliquots of cells suspension into new culture vessels. Subcultivation ration = 1:10 to 1:20 weekly. To achieve satisfactory results, cells should not be passaged over 16 times. Researchers should empirically determine the suitability of the mCD73 nt5e for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MRPAAAKVPK WLLLALSALL PQWPAASAWE LTILHTNDVH SRLEQTSDDS TKCLNASLCV GGVARLFTKV QQIRKEEPNV LFLDAGDQYQ GTIWFTVYKG LEVAHFMNIL GYDAMALGNH EFDNGVEGLI DPLLRNVKFP ILSANIKARG PLAHQISGLF LPSKVLSVGG EVVGIVGYTS KETPFLSNPG TNLVFEDEIS ALQPEVDKLK TLNVNKIIAL GHSGFEMDKL IAQKVRGVDI VVGGHSNTFL YTGNPPSKEV PAGKYPFIVT ADDGRQVPVV QAYAFGKYLG YLKVEFDDKG NVITSYGNPI LLNSSIPEDA TIKADINQWR IKLDNYSTQE LGRTIVYLDG STQTCRFREC NMGNLICDAM INNNLRHPDE MFWNHVSMCI VNGGGIRSPI DEKNNGTITW ENLAAVLPFG GTFDLVQLKG STLKKAFEHS VHRYGQSTGE FLQVGGIHVV YDINRKPWNR VVQLEVLCTK CRVPIYEPLE MDKVYKVTLP SYLANGGDGF QMIKDELLKH DSGDQDISVV SEYISKMKVV YPAVEGRIKF SAASHYQGSF PLVILSFWAM ILILYQ. It is sometimes possible for the material contained within the vial of "mCD73, Cell Line" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
