Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunoprecipitation (IP) (Immunoprecipitation of VAPA transfected lysate using VAPA rabbit polyclonal antibody and Protein A Magnetic Bead and immunoblotted with VAPA purified mouse polyclonal antibody)

Rabbit anti-Human VAPA Polyclonal Antibody | anti-VAPA antibody

VAPA (Vesicle-associated Membrane Protein-associated Protein A, VAMP-associated Protein A, VAMP-A, VAP-A, 33 kDa VAMP-associated Protein, VAP33, VAP-33, hVAP-33)

Gene Names
VAPA; VAP-A; VAP33; VAP-33; hVAP-33
Reactivity
Human
Applications
Immunoprecipitation
Purity
Serum
Serum
Synonyms
VAPA; Polyclonal Antibody; VAPA (Vesicle-associated Membrane Protein-associated Protein A; VAMP-associated Protein A; VAMP-A; VAP-A; 33 kDa VAMP-associated Protein; VAP33; VAP-33; hVAP-33); Anti -VAPA (Vesicle-associated Membrane Protein-associated Protein A; anti-VAPA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human VAPA.
Purity/Purification
Serum
Serum
Form/Format
Supplied as a liquid.
Sequence
MAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYCVRPNSGIIDPGSTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNTSDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLNDMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSTASFRDNVTSPLPSLLVVIAAIFIGFFLGKFIL
Applicable Applications for anti-VAPA antibody
Immunoprecipitation (IP)
Application Notes
Suitable for use in Immunoprecipitation.
Immunogen
Full length human VAPA, aa1-242 (ENSP00000217602)
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunoprecipitation (IP)

(Immunoprecipitation of VAPA transfected lysate using VAPA rabbit polyclonal antibody and Protein A Magnetic Bead and immunoblotted with VAPA purified mouse polyclonal antibody)

Immunoprecipitation (IP) (Immunoprecipitation of VAPA transfected lysate using VAPA rabbit polyclonal antibody and Protein A Magnetic Bead and immunoblotted with VAPA purified mouse polyclonal antibody)
Product Categories/Family for anti-VAPA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27,893 Da
NCBI Official Full Name
vesicle-associated membrane protein-associated protein A isoform 2
NCBI Official Synonym Full Names
VAMP (vesicle-associated membrane protein)-associated protein A, 33kDa
NCBI Official Symbol
VAPA
NCBI Official Synonym Symbols
VAP-A; VAP33; VAP-33; hVAP-33
NCBI Protein Information
vesicle-associated membrane protein-associated protein A; VAMP-A; VAMP-associated protein A; 33 kDa VAMP-associated protein
UniProt Protein Name
Vesicle-associated membrane protein-associated protein A
UniProt Gene Name
VAPA
UniProt Synonym Gene Names
VAP33; VAMP-A; VAMP-associated protein A; VAP-A; VAP-33
UniProt Entry Name
VAPA_HUMAN

NCBI Description

The protein encoded by this gene is a type IV membrane protein. It is present in the plasma membrane and intracellular vesicles. It may also be associated with the cytoskeleton. This protein may function in vesicle trafficking, membrane fusion, protein complex assembly and cell motility. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: May play a role in vesicle trafficking. Ref.9 Ref.10

Subunit structure: Homodimer, and heterodimer with VAPB. Interacts with VAMP1, VAMP2, STX1A, BET1, SEC22C and with the C-terminal domain of OCLN. Interacts with OSBPL1A. Interacts (via MSP domain) with ZFYVE27; may retain ZFYVE27 in the endoplasmic reticulum and regulate its function in cell projections formation. Interacts with OSBP. Interacts (via C-terminus) with RSAD2/viperin (via C-terminus). Interacts with HCV protein NS5A and NS5B. Ref.1 Ref.6 Ref.9 Ref.10 Ref.13 Ref.14

Subcellular location: Endoplasmic reticulum membrane; Single-pass type IV membrane protein. Note: Present in the plasma membrane and in intracellular vesicles, together with SNARE proteins. May also associate with the cytoskeleton. Colocalizes with OCLN at the tight junction in polarized epithelial cells. Ref.1 Ref.10

Tissue specificity: Ubiquitous.

Sequence similarities: Belongs to the VAMP-associated protein (VAP) (TC 9.B.17) family. [View classification]Contains 1 MSP domain.

Sequence caution: The sequence AAD09742.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.The sequence AAF72105.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.The sequence BG488667 differs from that shown. Reason: Frameshift at positions 72, 207 and 241.

Research Articles on VAPA

Similar Products

Product Notes

The VAPA vapa (Catalog #AAA648828) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The VAPA (Vesicle-associated Membrane Protein-associated Protein A, VAMP-associated Protein A, VAMP-A, VAP-A, 33 kDa VAMP-associated Protein, VAP33, VAP-33, hVAP-33) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's VAPA can be used in a range of immunoassay formats including, but not limited to, Immunoprecipitation (IP). Suitable for use in Immunoprecipitation. Researchers should empirically determine the suitability of the VAPA vapa for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAKHEQILVL DPPTDLKFKG PFTDVVTTNL KLRNPSDRKV CFKVKTTAPR RYCVRPNSGI IDPGSTVTVS VMLQPFDYDP NEKSKHKFMV QTIFAPPNTS DMEAVWKEAK PDELMDSKLR CVFEMPNEND KLNDMEPSKA VPLNASKQDG PMPKPHSVSL NDTETRKLME ECKRLQGEMM KLSEENRHLR DEGLRLRKVA HSDKPGSTST ASFRDNVTSP LPSLLVVIAA IFIGFFLGKF IL. It is sometimes possible for the material contained within the vial of "VAPA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.