Mouse anti-Human VAPA Monoclonal Antibody | anti-VAPA antibody

VAPA (Vesicle-associated Membrane Protein-associated Protein A, VAMP-associated Protein A, VAMP-A, VAP-A, 33 kDa VAMP-associated Protein, VAP33, VAP-33, hVAP-33)

Cat. Num. AAA6000068

• Gene Names: VAPA; VAP-A; VAP33; VAP-33; hVAP-33
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: VAPA; Monoclonal Antibody; VAPA (Vesicle-associated Membrane Protein-associated Protein A; VAMP-associated Protein A; VAMP-A; VAP-A; 33 kDa VAMP-associated Protein; VAP33; VAP-33; hVAP-33); Anti -VAPA (Vesicle-associated Membrane Protein-associated Protein A; anti-VAPA antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4C12
• Specificity: Recognizes human VAPA.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MAKHEQILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTTAPRRYCVRPNSGIIDPGSTVTVSVMLQPFDYDPNEKSKHKFMVQTIFAPPNTSDMEAVWKEAKPDELMDSKLRCVFEMPNENDKLNDMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSTASFRDNVTSPLPSLLVVIAAIFIGFFLGKFIL

• Applicable Applications for anti-VAPA antibody: ELISA (EL/EIA), Western Blot (WB)
• Application Notes: Suitable for use in ELISA and Western Blot.
• Immunogen: Full length recombinant corresponding to aa1-243 from VAPA (AAH02992) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (52.73kD).)

Western Blot (WB)

(VAPA monoclonal antibody Western Blot analysis of VAPA expression in human placenta.)

Western Blot (WB)

(VAPA monoclonal antibody Western Blot analysis of VAPA expression in K-562.)

Western Blot (WB)

(Western Blot analysis of VAPA expression in transfected 293T cell line by VAPA monoclonal antibody |Lane 1: VAPA transfected lysate (27.3kD).|Lane 2: Non-transfected lysate.)

Product Categories/Family for anti-VAPA antibody

Antibodies; Abs to Membrane Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 94721252
• NCBI GeneID: 9218
• NCBI Accession #: NP_919415.2
• NCBI GenBank Nucleotide #: NM_194434.2
• UniProt Accession #: Q9P0L0; O75453; Q5U0E7; Q9UBZ2; A6NDZ0; D3DUI3
• Molecular Weight: 27,893 Da
• NCBI Official Full Name: vesicle-associated membrane protein-associated protein A isoform 2
• NCBI Official Synonym Full Names: VAMP (vesicle-associated membrane protein)-associated protein A, 33kDa
• NCBI Official Symbol: VAPA
• NCBI Official Synonym Symbols: VAP-A; VAP33; VAP-33; hVAP-33
• NCBI Protein Information: vesicle-associated membrane protein-associated protein A; VAMP-A; VAMP-associated protein A; 33 kDa VAMP-associated protein
• UniProt Protein Name: Vesicle-associated membrane protein-associated protein A
• Protein Family: Virulence-associated protein
• UniProt Gene Name: VAPA
• UniProt Synonym Gene Names: VAP33; VAMP-A; VAMP-associated protein A; VAP-A; VAP-33
• UniProt Entry Name: VAPA_HUMAN

NCBI Description

The protein encoded by this gene is a type IV membrane protein. It is present in the plasma membrane and intracellular vesicles. It may also be associated with the cytoskeleton. This protein may function in vesicle trafficking, membrane fusion, protein complex assembly and cell motility. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

VAPA: May play a role in vesicle trafficking. Belongs to the VAMP-associated protein (VAP) (TC 9.B.17) family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Endoplasmic reticulum

Chromosomal Location of Human Ortholog: 18p11.22

Cellular Component: microtubule cytoskeleton; Golgi membrane; endoplasmic reticulum membrane; tight junction; perinuclear region of cytoplasm; endoplasmic reticulum; plasma membrane; integral to membrane; vesicle

Molecular Function: protein domain specific binding; protein binding; signal transducer activity; protein heterodimerization activity; FFAT motif binding; microtubule binding

Biological Process: endoplasmic reticulum organization and biogenesis; cell death; ER to Golgi vesicle-mediated transport; sphingolipid metabolic process; positive regulation of I-kappaB kinase/NF-kappaB cascade; sphingolipid biosynthetic process; signal transduction; neurite development