Rabbit anti-Human FGGY Polyclonal Antibody | anti-FGGY antibody

FGGY (FLJ10986, FGGY Carbohydrate Kinase Domain-containing Protein)

Cat. Num. AAA648515

• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: FGGY; Polyclonal Antibody; FGGY (FLJ10986; FGGY Carbohydrate Kinase Domain-containing Protein); Anti -FGGY (FLJ10986; anti-FGGY antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human FLJ10986.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MWLDHRAVSQVNRINETKHSVLQYVGGVMSVEMQAPKLLWLKENLREICWDKAGHFFDLPDFLSWKATGVTARSLCSLVCKWTYSAEKGWDDSFWKMIGLEDFVADNYSKIGNQVLPPGASLGNGLTPEAARDLGLLPGIAVAASLIDAHAGGLGVIGADVRGHGLICEGQPVTSRLAVICGTSSCHMGISKDPIFVPGVWGPYFSAMVPGFWLNEGGQSVTGKLIDHMVQGHAAFPELQVKATARCQSIYAYLNSHLDLIKKAQPVGFLTVDLHVWPDFHGNRSPLADLTLKGMVTGLKLSQDLDDLAILYLATVQAIALGTRFIIEAMEAAGHSISTLFLCGGLSKNPLFVQMHADITGMPVVLSQEVESVLVGAAVLGACASGDFASVQEAMAKMSKVGKVVFPRLQDKKYYDKKYQVFLKLVEHQKEYLAIMNDD

• Applicable Applications for anti-FGGY antibody: Western Blot (WB)
• Application Notes: Suitable for use in Western Blot.
• Immunogen: Full length human FLJ10986, aa1-439 (NP_060761.2).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(FLJ10986 rabbit polyclonal antibody. Western Blot analysis of FLJ10986 expression in HeLa.)

Western Blot (WB)

(Western Blot analysis of FGGY expression in transfected 293T cell line by FGGY polyclonal antibody. Lane 1: FLJ10986 transfected lysate (47.7kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-FGGY antibody

Expressed in kidney, lung and small intestine and to a lower extent in liver and detected in cerebrospinal fluid (at protein level).

Product Categories/Family for anti-FGGY antibody

Antibodies; Abs to Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 164663828
• NCBI GeneID: 55277
• NCBI Accession #: NP_060761.3
• NCBI GenBank Nucleotide #: NM_018291.3
• UniProt Accession #: Q96C11; Q9HA63; B1AK92; B1AK93; B1AK94; B2RDR8; D3DQ56
• Molecular Weight: 59,993 Da
• NCBI Official Full Name: FGGY carbohydrate kinase domain-containing protein isoform b
• NCBI Official Synonym Full Names: FGGY carbohydrate kinase domain containing
• NCBI Official Symbol: FGGY
• NCBI Protein Information: FGGY carbohydrate kinase domain-containing protein
• UniProt Protein Name: FGGY carbohydrate kinase domain-containing protein
• Protein Family: FGGY carbohydrate kinase domain-containing protein
• UniProt Gene Name: FGGY
• UniProt Entry Name: FGGY_HUMAN

NCBI Description

This gene encodes a protein that phosphorylates carbohydrates such as ribulose, ribitol, and L-arabinitol. Genome-wide association studies in some populations have found an association between polymorphisms in this gene and sporadic amyotrophic lateral sclerosis, but studies of other populations have not been able to replicate this association. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2013]

Uniprot Description

Tissue specificity: Expressed in kidney, lung and small intestine and to a lower extent in liver and detected in cerebrospinal fluid (at protein level). Ref.5

Developmental stage: Expressed in fetal brain (at protein level). Ref.5

Involvement in disease: Amyotrophic lateral sclerosis (ALS) [MIM:105400]: A neurodegenerative disorder affecting upper motor neurons in the brain and lower motor neurons in the brain stem and spinal cord, resulting in fatal paralysis. Sensory abnormalities are absent. The pathologic hallmarks of the disease include pallor of the corticospinal tract due to loss of motor neurons, presence of ubiquitin-positive inclusions within surviving motor neurons, and deposition of pathologic aggregates. The etiology of amyotrophic lateral sclerosis is likely to be multifactorial, involving both genetic and environmental factors. The disease is inherited in 5-10% of the cases.Note: Disease susceptibility is associated with variations affecting the gene represented in this entry.

Sequence similarities: Belongs to the FGGY kinase family.

Sequence caution: The sequence AAH14947.1 differs from that shown. Reason: Erroneous initiation.