Mouse anti-Human, Mouse MED20 Polyclonal Antibody | anti-med20 antibody

MED20 (Mediator of RNA Polymerase II Transcription Subunit 20, Mediator Complex Subunit 20, TRF-proximal Protein Homolog, hTRFP, TRFP)

Cat. Num. AAA648045

• Reactivity: Human, Mouse
• Applications: Western Blot, Immunofluorescence
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: MED20; Polyclonal Antibody; MED20 (Mediator of RNA Polymerase II Transcription Subunit 20; Mediator Complex Subunit 20; TRF-proximal Protein Homolog; hTRFP; TRFP); Anti -MED20 (Mediator of RNA Polymerase II Transcription Subunit 20; anti-med20 antibody

• Host: Mouse
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human MED20.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MGVTCVSQMPVAEGKSVQQTVELLTRKLEMLGAEKQGTFCVDCETYHTAASTLGSQGQTGKLMYVMHNSEYPLSCFALFENGPCLIADTNFDVLMVKLKGFFQSAKASKIETRGTRYQYCDFLVKVGTVTMGPSARGISVEVEYGPCVVASDCWSLLLEFLQSFLGSHTPGAPAVFGNRHDAVYGPADTMVQYMELFNKIRKQQQVPVAGIR

• Applicable Applications for anti-med20 antibody: Western Blot (WB), Immunofluorescence (IF)
• Application Notes: Suitable for use in Immunofluorescence and Western Blot.; Dilution: Immunofluorescence: 10ug/ml
• Immunogen: Full length human MED20, aa1-212 (NP_004266.2).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(TRFP polyclonal antibody. Western Blot analysis of TRFP expression in Hela NE.)

Western Blot (WB)

(Western Blot analysis of MED20 expression in transfected 293T cell line by MED20 polyclonal antibody. Lane 1: TRFP transfected lysate (23.32kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of purified antibody to TRFP on HeLa cell. [antibody concentration 10ug/ml])

Related Product Information for anti-med20 antibody

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.

Product Categories/Family for anti-med20 antibody

Antibodies; Abs to Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 429242436
• NCBI GeneID: 2542421
• NCBI Accession #: NP_593728.2
• NCBI GenBank Nucleotide #: NM_001019159.2
• UniProt Accession #: Q10317
• Molecular Weight: 22,350 Da
• NCBI Official Full Name: mediator complex subunit Med20
• NCBI Official Symbol: med20
• NCBI Protein Information: mediator complex subunit Med20
• UniProt Protein Name: Mediator of RNA polymerase II transcription subunit 20
• Protein Family: Putative mediator of RNA polymerase II transcription
• UniProt Gene Name: med20
• UniProt Entry Name: MED20_SCHPO

Uniprot Description

Function: Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. The Mediator complex, having a compact conformation in its free form, is recruited to promoters by direct interactions with regulatory proteins and serves for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. Ref.4

Subunit structure: Component of the Mediator complex. Ref.4

Subcellular location: Nucleus Ref.3.

Sequence similarities: Belongs to the Mediator complex subunit 20 family.