Western Blot (WB)
(Western Blot detection against Immunogen (37kD).)
Mouse anti-Human ANKRD15 Monoclonal Antibody | anti-Kank1 antibody
ANKRD15 (KN Motif and Ankyrin Repeat Domain-containing Protein 1, Ankyrin Repeat Domain-containing Protein 15, Kidney Ankyrin Repeat-containing Protein, KANK1, KANK, KIAA0172)
Gene Names
Kank1; Ankrd15
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
ANKRD15; Monoclonal Antibody; ANKRD15 (KN Motif and Ankyrin Repeat Domain-containing Protein 1; Ankyrin Repeat Domain-containing Protein 15; Kidney Ankyrin Repeat-containing Protein; KANK1; KANK; KIAA0172); Anti -ANKRD15 (KN Motif and Ankyrin Repeat Domain-containing Protein 1; anti-Kank1 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2B8
Specificity
Recognizes human ANKRD15.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MGSLNSQLISTLSSINSVMKSASTEELRNPDFQKTSLGKITGNYLGYTCKCGGLQSGSPLSSQTSQPEQEVGTSEGKPISSLDAFPTQEGTLSPVNLTDD
Applicable Applications for anti-Kank1 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa701-800 from ANKRD15 (AAH38116) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (37kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (37kD).)
Testing Data
(Detection limit for recombinant GST tagged ANKRD15 is ~0.1ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged ANKRD15 is ~0.1ng/ml as a capture antibody.)
Related Product Information for anti-Kank1 antibody
Involved in the control of cytoskeleton formation by regulating actin polymerization. Inhibits actin fiber formation and cell migration. Inhibits RhoA activity; the function involves phosphorylation through PI3K/Akt signaling and may depend on the competetive interaction with 14-3-3 adapter proteins to sequester them from active complexes. Inhibits the formation of lamellipodia but not of filopodia; the function may depend on the competetive interaction with BAIAP2 to block its association with activated RAC1. Inhibits fibronectin-mediated cell spreading; the function is partially mediated by BAIAP2. Inhibits neurite outgrowth. Involved in the establishment and persistence of cell polarity during directed cell movement in wound healing. In the nucleus, is involved in beta-catenin-dependent activation of transcription. Potential tumor suppressor for renal cell carcinoma.
Product Categories/Family for anti-Kank1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Official Full Name
Ankrd15 protein
NCBI Official Synonym Full Names
KN motif and ankyrin repeat domains 1
NCBI Official Symbol
Kank1
NCBI Official Synonym Symbols
Ankrd15
NCBI Protein Information
ankyrin repeat domain 15
Protein Family
Similar Products
Product Notes
The Kank1 (Catalog #AAA647819) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ANKRD15 (KN Motif and Ankyrin Repeat Domain-containing Protein 1, Ankyrin Repeat Domain-containing Protein 15, Kidney Ankyrin Repeat-containing Protein, KANK1, KANK, KIAA0172) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ANKRD15 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the Kank1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGSLNSQLIS TLSSINSVMK SASTEELRNP DFQKTSLGKI TGNYLGYTCK CGGLQSGSPL SSQTSQPEQE VGTSEGKPIS SLDAFPTQEG TLSPVNLTDD. It is sometimes possible for the material contained within the vial of "ANKRD15, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
