Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human RPS6KB2 Monoclonal Antibody | anti-RPS6KB2 antibody

RPS6KB2 (Ribosomal Protein S6 Kinase beta 2, S6K-beta-2, S6K2, 70kD Ribosomal Protein S6 Kinase 2, p70-S6K 2, P70S6K2, p70 Ribosomal S6 Kinase beta, p70 S6 Kinase beta, p70 S6K-beta, p70 S6KB, S6K-beta, p70-beta, S6 Kinase-related Kinase, SRK, Serine/Thre

Gene Names
RPS6KB2; KLS; SRK; S6K2; STK14B; p70S6Kb; P70-beta; S6K-beta2; P70-beta-1; P70-beta-2; p70(S6K)-beta
Reactivity
Human
Applications
ELISA, Western Blot, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
RPS6KB2; Monoclonal Antibody; RPS6KB2 (Ribosomal Protein S6 Kinase beta 2; S6K-beta-2; S6K2; 70kD Ribosomal Protein S6 Kinase 2; p70-S6K 2; P70S6K2; p70 Ribosomal S6 Kinase beta; p70 S6 Kinase beta; p70 S6K-beta; p70 S6KB; S6K-beta; p70-beta; S6 Kinase-related Kinase; SRK; Serine/Thre; Anti -RPS6KB2 (Ribosomal Protein S6 Kinase beta 2; anti-RPS6KB2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4B11
Specificity
Recognizes human RPS6KB2.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MAAVFDLDLETEEGSEGEGEPELSPADACPLAELRAAGLEPVGHYEEVELTETSVNVGPERIGPHSFELLRVLGKGGYGKVFQVRKVQGTNLGKIYAMKV
Applicable Applications for anti-RPS6KB2 antibody
ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF)
Application Notes
Suitable for use in Immunofluorescence, ELISA and Western Blot.
Dilution: Immunofluorescence: 10ug/ml
Immunogen
Partial recombinant corresponding to aa1-100 from human RPS6KB2 (AAH06106) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Related Product Information for anti-RPS6KB2 antibody
Phosphorylates specifically ribosomal protein S6.
Product Categories/Family for anti-RPS6KB2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53,455 Da
NCBI Official Full Name
ribosomal protein S6 kinase beta-2
NCBI Official Synonym Full Names
ribosomal protein S6 kinase, 70kDa, polypeptide 2
NCBI Official Symbol
RPS6KB2
NCBI Official Synonym Symbols
KLS; SRK; S6K2; STK14B; p70S6Kb; P70-beta; S6K-beta2; P70-beta-1; P70-beta-2; p70(S6K)-beta
NCBI Protein Information
ribosomal protein S6 kinase beta-2; P70S6K2; S6K-beta; p70 S6KB; p70-S6K 2; S6K-beta-2; p70 S6K-beta; p70 S6 kinase beta; S6 kinase-related kinase; p70 ribosomal S6 kinase beta; serine/threonine-protein kinase 14B; 70 kDa ribosomal protein S6 kinase 2; serine/threonine-protein kinase 14 beta
UniProt Protein Name
Ribosomal protein S6 kinase beta-2
UniProt Gene Name
RPS6KB2
UniProt Synonym Gene Names
STK14B; S6K-beta-2; S6K2; P70S6K2; p70-S6K 2; SRK; S6K-beta; p70 S6 kinase beta; p70 S6K-beta; p70 S6KB; p70-beta
UniProt Entry Name
KS6B2_HUMAN

NCBI Description

This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 nonidentical kinase catalytic domains and phosphorylates the S6 ribosomal protein and eucaryotic translation initiation factor 4B (eIF4B). Phosphorylation of S6 leads to an increase in protein synthesis and cell proliferation. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: Phosphorylates specifically ribosomal protein S6.

Catalytic activity: ATP + a protein = ADP + a phosphoprotein.

Subcellular location: Cytoplasm. Nucleus Ref.8 Ref.9.

Post-translational modification: Phosphorylated and activated by MTOR. Phosphorylation by PKC within the NLS in response to mitogenic stimuli causes cytoplasmic retention. Ref.8 Ref.9

Sequence similarities: Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. S6 kinase subfamily.Contains 1 AGC-kinase C-terminal domain.Contains 1 protein kinase domain.

Sequence caution: The sequence BAA34402.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

Research Articles on RPS6KB2

Similar Products

Product Notes

The RPS6KB2 rps6kb2 (Catalog #AAA646928) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RPS6KB2 (Ribosomal Protein S6 Kinase beta 2, S6K-beta-2, S6K2, 70kD Ribosomal Protein S6 Kinase 2, p70-S6K 2, P70S6K2, p70 Ribosomal S6 Kinase beta, p70 S6 Kinase beta, p70 S6K-beta, p70 S6KB, S6K-beta, p70-beta, S6 Kinase-related Kinase, SRK, Serine/Thre reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RPS6KB2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF). Suitable for use in Immunofluorescence, ELISA and Western Blot. Dilution: Immunofluorescence: 10ug/ml. Researchers should empirically determine the suitability of the RPS6KB2 rps6kb2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAAVFDLDLE TEEGSEGEGE PELSPADACP LAELRAAGLE PVGHYEEVEL TETSVNVGPE RIGPHSFELL RVLGKGGYGK VFQVRKVQGT NLGKIYAMKV. It is sometimes possible for the material contained within the vial of "RPS6KB2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.