Western Blot (WB)
(Western Blot detection against Immunogen (34.14kD).)
Mouse anti-Human COL23A1 Monoclonal Antibody | anti-COL23A1 antibody
COL23A1 (Collagen alpha-1(XXIII) Chain, DKFZp434K0621)
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
COL23A1; Monoclonal Antibody; COL23A1 (Collagen alpha-1(XXIII) Chain; DKFZp434K0621); Anti -COL23A1 (Collagen alpha-1(XXIII) Chain; anti-COL23A1 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2E10
Specificity
Recognizes human COL23A1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
KGELGLPGAPGIDGEKGPKGQKGDPGEPGPAGLKGEAGEMGLSGLPGADGLKGEKGESASDSLQESLAQLIVE
Applicable Applications for anti-COL23A1 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa338-411 from human COL23A1 (NP_775736) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (34.14kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (34.14kD).)
Testing Data
(Detection limit for recombinant GST tagged COL23A1 is ~0.1ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged COL23A1 is ~0.1ng/ml as a capture antibody.)
Related Product Information for anti-COL23A1 antibody
Collagen XXIII a1 (COL23A1) is an epithelial cell type 2 transmembrane glycoprotein with multiple collagen-like domains in its extracellular region. Intracellular furin-mediated cleavage of the molecule generates a 58kD shed fragment that forms disulfide-linked trimers. An alternately spliced isoform consists of nearly 300aa of the membrane proximal extracellular domain (ECD), flanked by substituted sequences. COL23A1 is upregulated in many transformed cell lines and serves as an indicator for tumor aggressiveness in prostate cancer. Within the ECD, human COL23A1 shares 89% aa sequence identity with mouse and rat COL23A1.
Product Categories/Family for anti-COL23A1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
51,944 Da
NCBI Official Full Name
collagen alpha-1(XXIII) chain
NCBI Official Synonym Full Names
collagen, type XXIII, alpha 1
NCBI Official Symbol
COL23A1
NCBI Protein Information
collagen alpha-1(XXIII) chain; collagen alpha-1(XXIII) chain; procollagen, type XXIII, alpha 1
UniProt Protein Name
Collagen alpha-1(XXIII) chain
Protein Family
UniProt Gene Name
COL23A1
UniProt Entry Name
CONA1_HUMAN
NCBI Description
COL23A1 is a member of the transmembrane collagens, a subfamily of the nonfibrillar collagens that contain a single pass hydrophobic transmembrane domain (Banyard et al., 2003 [PubMed 12644459]).[supplied by OMIM, Mar 2008]
Uniprot Description
Subunit structure: Homotrimer
By similarity.
Subcellular location: Cell membrane; Single-pass type II membrane protein; Extracellular side
By similarity.
Post-translational modification: Undergoes proteolytic cleavage by furin protease to yield a 60 kDa soluble form that forms a homotrimer and exhibits a low affinity interaction with heparin
By similarity.
Sequence similarities: Contains 5 collagen-like domains.
Research Articles on COL23A1
Similar Products
Product Notes
The COL23A1 col23a1 (Catalog #AAA646839) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The COL23A1 (Collagen alpha-1(XXIII) Chain, DKFZp434K0621) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's COL23A1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the COL23A1 col23a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: KGELGLPGAP GIDGEKGPKG QKGDPGEPGP AGLKGEAGEM GLSGLPGADG LKGEKGESAS DSLQESLAQL IVE. It is sometimes possible for the material contained within the vial of "COL23A1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
