Mouse anti-Human ABCC11 Monoclonal Antibody | anti-ABCC11 antibody

ABCC11 (MRP8, ATP-binding Cassette Sub-family C Member 11, Multidrug Resistance-associated Protein 8, EWWD, WW)

Cat. Num. AAA645712

• Gene Names: ABCC11; WW; EWWD; MRP8
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: ABCC11; Monoclonal Antibody; ABCC11 (MRP8; ATP-binding Cassette Sub-family C Member 11; Multidrug Resistance-associated Protein 8; EWWD; WW); Anti -ABCC11 (MRP8; anti-ABCC11 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4H6
• Specificity: Recognizes human ABCC11.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: FVPIAVKGLTNSKSAVMRFKKFFLQESPVFYVQTLQDPSKALVFEEATLSWQQTCPGIVNGALELERNGHASEGMTRPRDALGPEEEGNSLGPELHKINL

• Applicable Applications for anti-ABCC11 antibody: ELISA (EL/EIA), Western Blot (WB)
• Application Notes: Suitable for use in ELISA and Western Blot.
• Immunogen: Partial recombinant corresponding to aa433-533 from human ABCC11 (NP_115972) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Related Product Information for anti-ABCC11 antibody

ABCC11 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This ABC full transporter is a member of the MRP subfamily which is involved in multi-drug resistance. The product of this gene participates in physiological processes involving bile acids, conjugated steroids, and cyclic nucleotides. In addition, a SNP in this gene is responsible for determination of human earwax type. This gene and family member ABCC12 are determined to be derived by duplication and are both localized to chromosome 16q12.1.

Product Categories/Family for anti-ABCC11 antibody

Antibodies; Abs to Multi Drug Resistance (MDR)

NCBI and Uniprot Product Information

• NCBI GI #: 21729876
• NCBI GeneID: 85320
• NCBI Accession #: NP_660187.1
• NCBI GenBank Nucleotide #: NM_145186.2
• UniProt Accession #: Q96J66; Q8TDJ0; Q96JA6; Q9BX80
• Molecular Weight: 154,301 Da
• NCBI Official Full Name: ATP-binding cassette sub-family C member 11 isoform b
• NCBI Official Synonym Full Names: ATP-binding cassette, sub-family C (CFTR/MRP), member 11
• NCBI Official Symbol: ABCC11
• NCBI Official Synonym Symbols: WW; EWWD; MRP8
• NCBI Protein Information: ATP-binding cassette sub-family C member 11; multi-resistance protein 8; ATP-binding cassette protein C11; ATP-binding cassette transporter MRP8; multidrug resistance-associated protein 8; ATP-binding cassette transporter sub-family C member 11
• UniProt Protein Name: ATP-binding cassette sub-family C member 11
• Protein Family: ABC transporter C family
• UniProt Gene Name: ABCC11
• UniProt Synonym Gene Names: MRP8
• UniProt Entry Name: ABCCB_HUMAN

NCBI Description

The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This ABC full transporter is a member of the MRP subfamily which is involved in multi-drug resistance. The product of this gene participates in physiological processes involving bile acids, conjugated steroids, and cyclic nucleotides. In addition, a SNP in this gene is responsible for determination of human earwax type. This gene and family member ABCC12 are determined to be derived by duplication and are both localized to chromosome 16q12.1. Multiple alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: Participates in physiological processes involving bile acids, conjugated steroids and cyclic nucleotides. Enhances the cellular extrusion of cAMP and cGMP. Stimulates the ATP-dependent uptake of a range of physiological and synthetic lipophilic anions, including the glutathione S-conjugates leukotriene C4 and dinitrophenyl S-glutathione, steroid sulfates such as dehydroepiandrosterone 3-sulfate (DHEAS) and estrone 3-sulfate, glucuronides such as estradiol 17-beta-D-glucuronide (E217betaG), the monoanionic bile acids glycocholate and taurocholate, and methotrexate. Probably functions to secrete earwax. Ref.4 Ref.5 Ref.6

Subcellular location: Membrane; Multi-pass membrane protein.

Tissue specificity: Expressed in many tissues. Not expressed in kidney, spleen and colon. Highly expressed in breast cancer. Expressed at moderate levels in normal breast and testis and at very low levels in liver, brain and placenta. Ref.1 Ref.3

Polymorphism: The allele with Arg-184 is responsible for the dry earwax phenotype [

MIM:117800]. Human earwax is a Mendelian trait consisting of wet and dry types. The wet earwax is brownish and sticky, whereas the dry type lacks cerumen. The wet cerumen phenotype is completely dominant. The dry type is seen frequently (80-95%) among East Asians, but uncommon (0-3%) in populations of European and African origins. Intermediate frequencies (30-50%) of the dry type are seen in populations of Southern Asia, the Pacific Islands, Central Asia and Asia Minor, as well as among the Native North American and Inuit of Asian ancestry.

Sequence similarities: Belongs to the ABC transporter superfamily. ABCC family. Conjugate transporter (TC 3.A.1.208) subfamily. [View classification]Contains 2 ABC transmembrane type-1 domains.Contains 2 ABC transporter domains.