<
Western Blot (WB)
(Western Blot detection against Immunogen (37kD).)
Mouse anti-Human ARMC8 Monoclonal Antibody | anti-ARMC8 antibody
ARMC8 (Armadillo Repeat-containing Protein 8, S863-2, DKFZP434A043, HSPC056, MGC10058, MGC4880)
Gene Names
ARMC8; GID5; VID28; S863-2; HSPC056
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
ARMC8; Monoclonal Antibody; ARMC8 (Armadillo Repeat-containing Protein 8; S863-2; DKFZP434A043; HSPC056; MGC10058; MGC4880); Anti -ARMC8 (Armadillo Repeat-containing Protein 8; anti-ARMC8 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2D9
Specificity
Recognizes human ARMC8.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
AETLAYLIEPDVELQRIASITDHLIAMLADYFKYPSSVSAITDIKRLDHDLKHAHELRQAAFKLYASLGANDEDIRKKVSLGEGRPPVLTASRQGVTST*
Applicable Applications for anti-ARMC8 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa287-386 from human ARMC8 (NP_054873) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (37kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (37kD).)
Western Blot (WB)
(Western Blot analysis of ARMC8 expression in transfected 293T cell line by ARMC8 monoclonal antibody. Lane 1: ARMC8 transfected lysate (43kD).|Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of ARMC8 expression in transfected 293T cell line by ARMC8 monoclonal antibody. Lane 1: ARMC8 transfected lysate (43kD).|Lane 2: Non-transfected lysate.)
Immunoprecipitation (IP)
(Immunoprecipitation of ARMC8 transfected lysate using ARMC8 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with ARMC8 monoclonal antibody.)
Immunoprecipitation (IP)
(Immunoprecipitation of ARMC8 transfected lysate using ARMC8 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with ARMC8 monoclonal antibody.)
Testing Data
(Detection limit for recombinant GST tagged ARMC8 is ~0.03ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged ARMC8 is ~0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-ARMC8 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
75,509 Da
NCBI Official Full Name
armadillo repeat-containing protein 8 isoform 5
NCBI Official Synonym Full Names
armadillo repeat containing 8
NCBI Official Symbol
ARMC8
NCBI Official Synonym Symbols
GID5; VID28; S863-2; HSPC056
NCBI Protein Information
armadillo repeat-containing protein 8; GID complex subunit 5, VID28 homolog
UniProt Protein Name
Armadillo repeat-containing protein 8
Protein Family
UniProt Gene Name
ARMC8
UniProt Entry Name
ARMC8_HUMAN
Uniprot Description
ARMC8: 4 isoforms of the human protein are produced by alternative splicing.
Protein type: Unknown function
Chromosomal Location of Human Ortholog: 3q22.3
Research Articles on ARMC8
Similar Products
Product Notes
The ARMC8 armc8 (Catalog #AAA645494) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ARMC8 (Armadillo Repeat-containing Protein 8, S863-2, DKFZP434A043, HSPC056, MGC10058, MGC4880) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ARMC8 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the ARMC8 armc8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: AETLAYLIEP DVELQRIASI TDHLIAMLAD YFKYPSSVSA ITDIKRLDHD LKHAHELRQA AFKLYASLGA NDEDIRKKVS LGEGRPPVLT ASRQGVTST*. It is sometimes possible for the material contained within the vial of "ARMC8, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
