Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of ZNF323 expression in transfected 293T cell line by ZNF323 monoclonal antibody.|Lane 1: ZNF323 transfected lysate (47.3kD).|Lane 2: Non-transfected lysate.)

Mouse anti-Human ZNF323 Monoclonal Antibody | anti-ZSCAN31 antibody

ZNF323 (Zinc Finger Protein 323, Zinc finger and SCAN Domain-containing Protein 31, ZSCAN31, ZNF20-Lp, ZNF310P, dJ874C20.2)

Gene Names
ZSCAN31; ZNF323; ZNF310P; ZNF20-Lp; dJ874C20.2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
ZNF323; Monoclonal Antibody; ZNF323 (Zinc Finger Protein 323; Zinc finger and SCAN Domain-containing Protein 31; ZSCAN31; ZNF20-Lp; ZNF310P; dJ874C20.2); Anti -ZNF323 (Zinc Finger Protein 323; anti-ZSCAN31 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4F7
Specificity
Recognizes human ZNF323.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MEHLGDSKLQRDVSLDSKYRETCKRDSKAEKQQAHSTGERRHRCNECGKSFTKSSVLIEHQRIHTGEKPYECEECGKAFSRRSSLNEHRRSHTGEKPYQCKECGKAFSASNGLTRHRRIHTGEKPYECKVCGKAFLLSSCLVQHQRIHTGEKRYQCRECGKAFIQNTGLFQHLRVHTGEKPYQCSQCSKLFSKRTLLRKHQKIHTGERP
Applicable Applications for anti-ZSCAN31 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Full length recombinant corresponding to aa1-210 from human ZNF323 (AAH08490) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of ZNF323 expression in transfected 293T cell line by ZNF323 monoclonal antibody.|Lane 1: ZNF323 transfected lysate (47.3kD).|Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ZNF323 expression in transfected 293T cell line by ZNF323 monoclonal antibody.|Lane 1: ZNF323 transfected lysate (47.3kD).|Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged ZNF323 is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ZNF323 is 0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-ZSCAN31 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47,293 Da
NCBI Official Full Name
zinc finger and SCAN domain-containing protein 31 isoform 2
NCBI Official Synonym Full Names
zinc finger and SCAN domain containing 31
NCBI Official Symbol
ZSCAN31
NCBI Official Synonym Symbols
ZNF323; ZNF310P; ZNF20-Lp; dJ874C20.2
NCBI Protein Information
zinc finger and SCAN domain-containing protein 31; zinc finger protein 323; zinc finger protein 310 pseudogene
UniProt Protein Name
Zinc finger and SCAN domain-containing protein 31
UniProt Gene Name
ZSCAN31
UniProt Synonym Gene Names
ZNF310P; ZNF323
UniProt Entry Name
ZSC31_HUMAN

NCBI Description

ZNF323 is a member of the subfamily of C2H2 Kruppel-like zinc finger transcription factors that have a SCAN box domain (Pi et al., 2002 [PubMed 12147252]).[supplied by OMIM, Mar 2008]

Uniprot Description

ZNF323: May function as a transcription factor. May be involved in the development of multiple embryonic organs. Belongs to the krueppel C2H2-type zinc-finger protein family.

Protein type: DNA-binding; C2H2-type zinc finger protein

Chromosomal Location of Human Ortholog: 6p21.31|6p22.3-p22.1

Cellular Component: nucleus

Molecular Function: DNA binding; metal ion binding; transcription factor activity

Biological Process: transcription, DNA-dependent; regulation of transcription, DNA-dependent

Research Articles on ZSCAN31

Similar Products

Product Notes

The ZSCAN31 zscan31 (Catalog #AAA644598) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ZNF323 (Zinc Finger Protein 323, Zinc finger and SCAN Domain-containing Protein 31, ZSCAN31, ZNF20-Lp, ZNF310P, dJ874C20.2) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF323 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the ZSCAN31 zscan31 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MEHLGDSKLQ RDVSLDSKYR ETCKRDSKAE KQQAHSTGER RHRCNECGKS FTKSSVLIEH QRIHTGEKPY ECEECGKAFS RRSSLNEHRR SHTGEKPYQC KECGKAFSAS NGLTRHRRIH TGEKPYECKV CGKAFLLSSC LVQHQRIHTG EKRYQCRECG KAFIQNTGLF QHLRVHTGEK PYQCSQCSKL FSKRTLLRKH QKIHTGERP. It is sometimes possible for the material contained within the vial of "ZNF323, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.