Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of CEP27 expression in transfected 293T cell line by CEP27 polyclonal antibody. Lane 1: CEP27 transfected lysate (25.85kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human CEP27 Polyclonal Antibody | anti-HAUS2 antibody

CEP27 (HAUS Augmin-like Complex Subunit 2, Centrosomal Protein of 27 kDa, HAUS2, C15orf25, FLJ10460)

Gene Names
HAUS2; CEP27; C15orf25; HsT17025
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
CEP27; Polyclonal Antibody; CEP27 (HAUS Augmin-like Complex Subunit 2; Centrosomal Protein of 27 kDa; HAUS2; C15orf25; FLJ10460); Anti -CEP27 (HAUS Augmin-like Complex Subunit 2; anti-HAUS2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CEP27.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MAAANPWDPASAPNGAGLVLGHFIASGMVNQEMLNMSKKTVSCFVNFTRLQQITNIQAEIYQKNLEIELLKLEKDTADVVHPFFLAQKCHTLQSMNNHLEAVLKEKRSLRQRLLKPMCQENLPIEAVYHRYMVHLLELAVTFIERLETHLETIRNIPHLAANLKKMNQALAKMDILVTETEELAENILKWRKQQNEVSSCIPKILAEESYLYKHDIIMPPLPFTSKVHVQTINAK
Applicable Applications for anti-HAUS2 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human CEP27, aa1-235 (NP_060567).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CEP27 expression in transfected 293T cell line by CEP27 polyclonal antibody. Lane 1: CEP27 transfected lysate (25.85kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CEP27 expression in transfected 293T cell line by CEP27 polyclonal antibody. Lane 1: CEP27 transfected lysate (25.85kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-HAUS2 antibody
Contributes to mitotic spindle assembly, maintenance of centrosome integrity and completion of cytokinesis as part of the HAUS augmin-like complex.
Product Categories/Family for anti-HAUS2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
26,933 Da
NCBI Official Full Name
centrosomal protein 27kDa, isoform CRA_a
NCBI Official Synonym Full Names
HAUS augmin-like complex, subunit 2
NCBI Official Symbol
HAUS2
NCBI Official Synonym Symbols
CEP27; C15orf25; HsT17025
NCBI Protein Information
HAUS augmin-like complex subunit 2; centrosomal protein 27kDa; centrosomal protein of 27 kDa
UniProt Protein Name
HAUS augmin-like complex subunit 2
Protein Family
UniProt Gene Name
HAUS2
UniProt Synonym Gene Names
C15orf25; CEP27; Cep27
UniProt Entry Name
HAUS2_HUMAN

NCBI Description

HAUS2 is 1 of 8 subunits of the 390-kD human augmin complex, or HAUS complex. The augmin complex was first identified in Drosophila, and its name comes from the Latin verb 'augmentare,' meaning 'to increase.' The augmin complex is a microtubule-binding complex involved in microtubule generation within the mitotic spindle and is vital to mitotic spindle assembly (Goshima et al., 2008 [PubMed 18443220]; Uehara et al., 2009 [PubMed 19369198]).[supplied by OMIM, Jun 2010]

Uniprot Description

HAUS2: Contributes to mitotic spindle assembly, maintenance of centrosome integrity and completion of cytokinesis as part of the HAUS augmin-like complex. Belongs to the HAUS2 family. 3 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 15q15.2

Cellular Component: nucleoplasm; Golgi apparatus; centrosome; microtubule; cytoplasm; spindle; cytosol

Biological Process: mitosis; centrosome organization and biogenesis; cell division; organelle organization and biogenesis; mitotic cell cycle; spindle assembly; G2/M transition of mitotic cell cycle

Similar Products

Product Notes

The HAUS2 haus2 (Catalog #AAA644520) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CEP27 (HAUS Augmin-like Complex Subunit 2, Centrosomal Protein of 27 kDa, HAUS2, C15orf25, FLJ10460) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CEP27 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the HAUS2 haus2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAAANPWDPA SAPNGAGLVL GHFIASGMVN QEMLNMSKKT VSCFVNFTRL QQITNIQAEI YQKNLEIELL KLEKDTADVV HPFFLAQKCH TLQSMNNHLE AVLKEKRSLR QRLLKPMCQE NLPIEAVYHR YMVHLLELAV TFIERLETHL ETIRNIPHLA ANLKKMNQAL AKMDILVTET EELAENILKW RKQQNEVSSC IPKILAEESY LYKHDIIMPP LPFTSKVHVQ TINAK. It is sometimes possible for the material contained within the vial of "CEP27, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.