Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (69.23kD).)

Mouse anti-Human ANO10 Monoclonal Antibody | anti-ANO10 antibody

ANO10 (Anoctamin-10, Transmembrane Protein 16K, TMEM16K, FLJ10375, Anoctamin 10, MGC47890)

Gene Names
ANO10; SCAR10; TMEM16K
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
ANO10; Monoclonal Antibody; ANO10 (Anoctamin-10; Transmembrane Protein 16K; TMEM16K; FLJ10375; Anoctamin 10; MGC47890); Anti -ANO10 (Anoctamin-10; anti-ANO10 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2B12-1A11
Specificity
Recognizes human FLJ10375.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MLLGAEAVGLVKECNDNTMRAFTYRTRQNFKGFDDNNDDFLTMAECQFIIKHELENLRAKDEKMIPGYPQAKLYPGKSLLRRLLTSGIVIQVFPLHDSEALKKLEDTWYTRFALKYQPIENHRLESAYQNHLILKVLVFNFLNCFASLFYIAFVLKDMKLLRQSLATLLITSQILNQIMESFLPYWLQRKHGVRVKRKVQALKADIDATLYEQVILEKEMGTYLGTFDDYLELFLQFGYVSLFSCVYPLAAAFAVLNNFTEVNSDALKMCRVFKRPFSEPSANIGVWQLAFEMMSVISVVTNCALIGMSPQVNAAFPESKADLILIVVAVEHALLALKFILAFAIPDKPRHIQMKLARLEFESLEALKQQQMKLVTENLKEEPMESGKEKAT
Applicable Applications for anti-ANO10 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Full length recombinant corresponding to aa1-393 from human FLJ10375 (AAH38855) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (69.23kD).)

Western Blot (WB) (Western Blot detection against Immunogen (69.23kD).)
Related Product Information for anti-ANO10 antibody
Does not exhibit calcium-activated chloride channel (CaCC) activity. Can inhibit the activity of ANO1.
Product Categories/Family for anti-ANO10 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
76,329 Da
NCBI Official Full Name
anoctamin-10 isoform 5
NCBI Official Synonym Full Names
anoctamin 10
NCBI Official Symbol
ANO10
NCBI Official Synonym Symbols
SCAR10; TMEM16K
NCBI Protein Information
anoctamin-10; transmembrane protein 16K
UniProt Protein Name
Anoctamin-10
Protein Family
UniProt Gene Name
ANO10
UniProt Synonym Gene Names
TMEM16K
UniProt Entry Name
ANO10_HUMAN

NCBI Description

The transmembrane protein encoded by this gene is a member of a family of calcium-activated chloride channels. Defects in this gene may be a cause of autosomal recessive spinocerebellar ataxia-10. Several transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Mar 2011]

Uniprot Description

ANO10: May act as a calcium-activated chloride channel. Defects in ANO10 are the cause of spinocerebellar ataxia autosomal recessive type 10 (SCAR10). Spinocerebellar ataxia is a clinically and genetically heterogeneous group of cerebellar disorders. Patients show progressive incoordination of gait and often poor coordination of hands, speech and eye movements, due to degeneration of the cerebellum with variable involvement of the brainstem and spinal cord. SCAR10 is characterized by onset in the teenage or young adult years of gait and limb ataxia, dysarthria, and nystagmus associated with marked cerebellar atrophy on brain imaging. Belongs to the anoctamin family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Transporter, ion channel; Membrane protein, integral; Transporter; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 3p22.1

Cellular Component: membrane; integral to membrane; plasma membrane; intracellular

Molecular Function: intracellular calcium activated chloride channel activity; calcium activated cation channel activity

Biological Process: chloride transport; transmembrane transport; cation transport

Disease: Spinocerebellar Ataxia, Autosomal Recessive 10

Research Articles on ANO10

Similar Products

Product Notes

The ANO10 ano10 (Catalog #AAA644113) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ANO10 (Anoctamin-10, Transmembrane Protein 16K, TMEM16K, FLJ10375, Anoctamin 10, MGC47890) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ANO10 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the ANO10 ano10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MLLGAEAVGL VKECNDNTMR AFTYRTRQNF KGFDDNNDDF LTMAECQFII KHELENLRAK DEKMIPGYPQ AKLYPGKSLL RRLLTSGIVI QVFPLHDSEA LKKLEDTWYT RFALKYQPIE NHRLESAYQN HLILKVLVFN FLNCFASLFY IAFVLKDMKL LRQSLATLLI TSQILNQIME SFLPYWLQRK HGVRVKRKVQ ALKADIDATL YEQVILEKEM GTYLGTFDDY LELFLQFGYV SLFSCVYPLA AAFAVLNNFT EVNSDALKMC RVFKRPFSEP SANIGVWQLA FEMMSVISVV TNCALIGMSP QVNAAFPESK ADLILIVVAV EHALLALKFI LAFAIPDKPR HIQMKLARLE FESLEALKQQ QMKLVTENLK EEPMESGKEK AT. It is sometimes possible for the material contained within the vial of "ANO10, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.