Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human TSNAX Monoclonal Antibody | anti-TSNAX antibody

TSNAX (Translin-associated Protein X, Translin-associated Factor X, TRAX)

Gene Names
TSNAX; TRAX
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Ascites
Ascites
Synonyms
TSNAX; Monoclonal Antibody; TSNAX (Translin-associated Protein X; Translin-associated Factor X; TRAX); Anti -TSNAX (Translin-associated Protein X; anti-TSNAX antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgM,k
Clone Number
4D5
Specificity
Recognizes human TSNAX.
Purity/Purification
Ascites
Ascites
Form/Format
Supplied as a liquid in ascites fluid.
Sequence
VADLTGELMRMCINSVGNGDIDTPFEVSQFLRQVYDGFSFIGNTGPYEVSKKLYTLKQSLAKVENACYALKVRGSEIPKHMLADVFSVKTEMIDQEEGIS
Applicable Applications for anti-TSNAX antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa191-290 from human TSNAX with GST tag.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)
Related Product Information for anti-TSNAX antibody
This gene encodes a protein which specifically interacts with translin, a DNA-binding protein that binds consensus sequences at breakpoint junctions of chromosomal translocations. The encoded protein contains bipartite nuclear targeting sequences that may provide nuclear transport for translin, which lacks any nuclear targeting motifs.
Product Categories/Family for anti-TSNAX antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33,112 Da
NCBI Official Full Name
translin-associated protein X
NCBI Official Synonym Full Names
translin-associated factor X
NCBI Official Symbol
TSNAX
NCBI Official Synonym Symbols
TRAX
NCBI Protein Information
translin-associated protein X; translin-like protein
UniProt Protein Name
Translin-associated protein X
UniProt Gene Name
TSNAX
UniProt Synonym Gene Names
TRAX
UniProt Entry Name
TSNAX_HUMAN

NCBI Description

This gene encodes a protein which specifically interacts with translin, a DNA-binding protein that binds consensus sequences at breakpoint junctions of chromosomal translocations. The encoded protein contains bipartite nuclear targeting sequences that may provide nuclear transport for translin, which lacks any nuclear targeting motifs. [provided by RefSeq, Jul 2008]

Uniprot Description

TSNAX: Acts in combination with TSN as an endonuclease involved in the activation of the RNA-induced silencing complex (RISC). Possible role in spermatogenesis. Belongs to the translin family.

Protein type: Nuclear receptor co-regulator; DNA-binding

Chromosomal Location of Human Ortholog: 1q42.1

Cellular Component: Golgi apparatus; perinuclear region of cytoplasm; cytoplasm; cytosol; nucleus

Molecular Function: endoribonuclease activity; DNA binding; sequence-specific DNA binding; metal ion binding; protein transporter activity; single-stranded DNA binding

Biological Process: protein transport; multicellular organismal development; gene expression; spermatogenesis; cell differentiation

Research Articles on TSNAX

Similar Products

Product Notes

The TSNAX tsnax (Catalog #AAA644025) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The TSNAX (Translin-associated Protein X, Translin-associated Factor X, TRAX) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TSNAX can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the TSNAX tsnax for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: VADLTGELMR MCINSVGNGD IDTPFEVSQF LRQVYDGFSF IGNTGPYEVS KKLYTLKQSL AKVENACYAL KVRGSEIPKH MLADVFSVKT EMIDQEEGIS. It is sometimes possible for the material contained within the vial of "TSNAX, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.