Rabbit anti-Human NFATC2IP Polyclonal Antibody | anti-NFATC2IP antibody

NFATC2IP (Nuclear Factor Of Activated T-Cells, Cytoplasmic, Calcineurin-Dependent 2 Interacting Protein, FLJ14639, MGC126790, MGC138387)

Cat. Num. AAA642266

• Gene Names: NFATC2IP; ESC2; NIP45; RAD60
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: NFATC2IP; Polyclonal Antibody; NFATC2IP (Nuclear Factor Of Activated T-Cells; Cytoplasmic; Calcineurin-Dependent 2 Interacting Protein; FLJ14639; MGC126790; MGC138387); Anti -NFATC2IP (Nuclear Factor Of Activated T-Cells; anti-NFATC2IP antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human NFATC2IP.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MSEPLQSVVDHMATHLGVSPSRILLLFGETELSPTATPRTLKLGVADIIDCVVLTSSPEATETSQQLQLRVQGKEKHQTLEVSLSRDSPLKTLMSHYEEAMGLSGRKLSFFFDGTKLSGRELPADLGMESGDLIEVWG

• Applicable Applications for anti-NFATC2IP antibody: Western Blot (WB)
• Application Notes: Suitable for use in Western Blot.
• Immunogen: Full length human NFATC2IP, aa1-138 (AAH21551.1).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of NFATC2IP expression in transfected 293T cell line by NFATC2IP polyclonal antibody. Lane 1: NFATC2IP transfected lysate (15.1kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-NFATC2IP antibody

Plays a role in the inducible expression of cytokine genes in T-cells, especially by increasing NFAT-driven IL-4 production.

Product Categories/Family for anti-NFATC2IP antibody

Antibodies; Abs to Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 51873914
• NCBI GeneID: 84901
• UniProt Accession #: Q8NCF5; Q66K34; Q6NVK1; Q8NFR2; Q96ST9; B7Z4G5
• Molecular Weight: 45,817 Da
• NCBI Official Full Name: NFATC2IP protein, partial
• NCBI Official Synonym Full Names: nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 interacting protein
• NCBI Official Symbol: NFATC2IP
• NCBI Official Synonym Symbols: ESC2; NIP45; RAD60
• NCBI Protein Information: NFATC2-interacting protein; 45 kDa NFAT-interacting protein; 45 kDa NF-AT-interacting protein; nuclear factor of activated T-cells, cytoplasmic 2-interacting protein
• UniProt Protein Name: NFATC2-interacting protein
• Protein Family: NFATC2-interacting protein
• UniProt Gene Name: NFATC2IP
• UniProt Synonym Gene Names: NIP45; 45 kDa NFAT-interacting protein
• UniProt Entry Name: NF2IP_HUMAN

Uniprot Description

NFATC2IP: In T-helper 2 (Th2) cells, regulates the magnitude of NFAT-driven transcription of a specific subset of cytokine genes, including IL3, IL4, IL5 and IL13, but not IL2. Recruits PRMT1 to the IL4 promoter; this leads to enhancement of histone H4 'Arg-3'- methylation and facilitates subsequent histone acetylation at the IL4 locus, thus promotes robust cytokine expression. Down-regulates formation of poly-SUMO chains by UBE2I/UBC9. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 16p11.2

Cellular Component: cytoplasm; nucleus

Biological Process: cytokine production; positive regulation of transcription from RNA polymerase II promoter