Western Blot (WB)
(Western Blot analysis of SRP19 expression in transfected 293T cell line by SRP19 polyclonal antibody. Lane 1: SRP19 transfected lysate (16.2kD). Lane 2: Non-transfected lysate.)
Rabbit anti-Human SRP19 Polyclonal Antibody | anti-srp19 antibody
SRP19 (Signal Recognition Particle 19kD Protein)
Reactivity
Human
Applications
Western Blot, Immunoprecipitation
Purity
SerumSerum
Synonyms
SRP19; Polyclonal Antibody; SRP19 (Signal Recognition Particle 19kD Protein); Anti -SRP19 (Signal Recognition Particle 19kD Protein); anti-srp19 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human SRP19.
Purity/Purification
Serum
Serum
Serum
Form/Format
Supplied as a liquid.
Sequence
MACAAARSPADQDRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNVFLEKNKMYSREWNRDVQYRGRVRVQLKQEDGSLCLVQFPSRKSVMLYAAEMIPKLKTRTQKTGGADQSLQQGEGSKKGKGKKKK
Applicable Applications for anti-srp19 antibody
Western Blot (WB), Immunoprecipitation (IP)
Application Notes
Suitable for use in Western Blot and Immunoprecipitation.
Immunogen
Full length human SRP19, aa1-144 (NP_003126.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of SRP19 expression in transfected 293T cell line by SRP19 polyclonal antibody. Lane 1: SRP19 transfected lysate (16.2kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of SRP19 expression in transfected 293T cell line by SRP19 polyclonal antibody. Lane 1: SRP19 transfected lysate (16.2kD). Lane 2: Non-transfected lysate.)
Immunoprecipitation (IP)
(Immunoprecipitation of SRP19 transfected lysate using SRP19 rabbit polyclonal antibody and Protein A Magnetic Bead and immunoblotted with SRP19 mouse polyclonal antibody.)
Immunoprecipitation (IP)
(Immunoprecipitation of SRP19 transfected lysate using SRP19 rabbit polyclonal antibody and Protein A Magnetic Bead and immunoblotted with SRP19 mouse polyclonal antibody.)
Related Product Information for anti-srp19 antibody
Signal-recognition-particle assembly, binds directly to 7S RNA and mediates binding of the 54kD subunit of the SRP.
Product Categories/Family for anti-srp19 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
12,405 Da
NCBI Official Full Name
Signal recognition particle 19 kDa protein
NCBI Official Symbol
srp19
NCBI Protein Information
signal recognition particle subunit 19
UniProt Protein Name
Signal recognition particle 19 kDa protein
Protein Family
UniProt Gene Name
srp19
UniProt Synonym Gene Names
SRP19
UniProt Entry Name
SRP19_ARCFU
Uniprot Description
Function: Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP. Ref.2 Ref.3
Subunit structure: Part of the signal recognition particle protein translocation system, which is composed of SRP and FtsY. Archaeal SRP consists of a 7S RNA molecule of 300 nucleotides and two protein subunits: SRP54 and SRP19. Ref.2 Ref.3
Subcellular location: Cytoplasm Ref.2 Ref.3.
Sequence similarities: Belongs to the SRP19 family.
Similar Products
Product Notes
The srp19 srp19 (Catalog #AAA641156) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SRP19 (Signal Recognition Particle 19kD Protein) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SRP19 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunoprecipitation (IP). Suitable for use in Western Blot and Immunoprecipitation. Researchers should empirically determine the suitability of the srp19 srp19 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MACAAARSPA DQDRFICIYP AYLNNKKTIA EGRRIPISKA VENPTATEIQ DVCSAVGLNV FLEKNKMYSR EWNRDVQYRG RVRVQLKQED GSLCLVQFPS RKSVMLYAAE MIPKLKTRTQ KTGGADQSLQ QGEGSKKGKG KKKK. It is sometimes possible for the material contained within the vial of "SRP19, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
