Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of SRP19 expression in transfected 293T cell line by SRP19 polyclonal antibody. Lane 1: SRP19 transfected lysate (16.2kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human SRP19 Polyclonal Antibody | anti-SRP19 antibody

SRP19 (Signal Recognition Particle 19kD Protein) (PE)

Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SRP19; Polyclonal Antibody; SRP19 (Signal Recognition Particle 19kD Protein) (PE); anti-SRP19 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human SRP19.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-SRP19 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human SRP19, aa1-144 (NP_003126.1).
Immunogen Sequence
MACAAARSPADQDRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNVFLEKNKMYSREWNRDVQYRGRVRVQLKQEDGSLCLVQFPSRKSVMLYAAEMIPKLKTRTQKTGGADQSLQQGEGSKKGKGKKKK
Conjugate
PE
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of SRP19 expression in transfected 293T cell line by SRP19 polyclonal antibody. Lane 1: SRP19 transfected lysate (16.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SRP19 expression in transfected 293T cell line by SRP19 polyclonal antibody. Lane 1: SRP19 transfected lysate (16.2kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-SRP19 antibody
Signal-recognition-particle assembly, binds directly to 7S RNA and mediates binding of the 54kD subunit of the SRP.
Product Categories/Family for anti-SRP19 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
signal recognition particle 19 kDa protein isoform 1
NCBI Official Synonym Full Names
signal recognition particle 19
NCBI Official Symbol
SRP19
NCBI Protein Information
signal recognition particle 19 kDa protein
UniProt Protein Name
Signal recognition particle 19 kDa protein
UniProt Gene Name
SRP19
UniProt Synonym Gene Names
SRP19
UniProt Entry Name
SRP19_HUMAN

Uniprot Description

SRP19: Signal-recognition-particle assembly, binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP. Belongs to the SRP19 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: RNA-binding

Chromosomal Location of Human Ortholog: 5q21-q22

Cellular Component: nucleoplasm; mitochondrion; cytoplasm; nucleolus; signal recognition particle, endoplasmic reticulum targeting; cytosol; nucleus

Molecular Function: 7S RNA binding

Biological Process: response to drug; SRP-dependent cotranslational protein targeting to membrane; cellular protein metabolic process; translation; gene expression; cotranslational protein targeting to membrane

Research Articles on SRP19

Similar Products

Product Notes

The SRP19 srp19 (Catalog #AAA6395080) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SRP19 (Signal Recognition Particle 19kD Protein) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SRP19 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SRP19 srp19 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SRP19, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.