Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit SLC22A1 Polyclonal Antibody | anti-SLC22A1 antibody

SLC22A1 (OCT1, Solute Carrier Family 22 Member 1, Organic Cation Transporter 1, HOCT1) (AP)

Reactivity
Human, Mouse, Rat, Canine
Applications
Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SLC22A1; Polyclonal Antibody; SLC22A1 (OCT1; Solute Carrier Family 22 Member 1; Organic Cation Transporter 1; HOCT1) (AP); anti-SLC22A1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat, Canine
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes SLC22A1. Species Crossreactivity: Human, mouse, rat and canine.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-SLC22A1 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IHC: 4-8ug/ml
WB: 2.5ug/ml
Applications are based on unconjugated antibody.
Immunogen
Synthetic peptide corresponding to LSCVDPLASLATNRSHLPLGPCQDGWVYDTPGSSIVTEFNLVCADSWKLD
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Lyophilized powder may be stored at -20 degree C. Stable for 12 months at -20 degree C. Reconstitute with sterile dH2O. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Reconstituted product is stable for 12 months at -20 degree C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Product Categories/Family for anti-SLC22A1 antibody

Similar Products

Product Notes

The SLC22A1 (Catalog #AAA6402462) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC22A1 (OCT1, Solute Carrier Family 22 Member 1, Organic Cation Transporter 1, HOCT1) (AP) reacts with Human, Mouse, Rat, Canine and may cross-react with other species as described in the data sheet. AAA Biotech's SLC22A1 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). IHC: 4-8ug/ml WB: 2.5ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SLC22A1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC22A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.