Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human USE1 Polyclonal Antibody | anti-USE1 antibody

USE1 (Vesicle Transport Protein USE1, MDS032, p31, Putative MAPK-activating Protein PM26, SLT1, USE1-like Protein, USE1L) (MaxLight 490)

Gene Names
USE1; D12; P31; SLT1; MDS032
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
USE1; Polyclonal Antibody; USE1 (Vesicle Transport Protein USE1; MDS032; p31; Putative MAPK-activating Protein PM26; SLT1; USE1-like Protein; USE1L) (MaxLight 490); anti-USE1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human USE1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Applicable Applications for anti-USE1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human USE1, aa1-259 (NP_060937.1).
Immunogen Sequence
MAASRLELNLVRLLSRCEAMAAEKRDPDEWRLEKYVGALEDMLQALKVHASKPASEVINEYSWKVDFLKGMLQAEKLTSSSEKALANQFLAPGRVPTTARERVPATKTVHLQSRARYTSEMRSELLGTDSAEPEMDVRKRTGVAGSQPVSEKQSAAELDLVLQRHQNLQEKLAEEMLGLARSLKTNTLAAQSVIKKDNQTLSHSLKMADQNLEKLKTESERLEQHTQKSVNWLLWAMLIIVCFIFISMILFIRIMPKLK
Conjugate
MaxLight490
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-USE1 antibody
MaxLight490 is a new Blue-Green photostable dye conjugate comparable to DyLight488, Alexa Fluor488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000.
Product Categories/Family for anti-USE1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15,063 Da
NCBI Official Full Name
vesicle transport protein USE1
NCBI Official Synonym Full Names
unconventional SNARE in the ER 1 homolog (S. cerevisiae)
NCBI Official Symbol
USE1
NCBI Official Synonym Symbols
D12; P31; SLT1; MDS032
NCBI Protein Information
vesicle transport protein USE1; Q-SNARE; SNARE-like tail-anchored protein 1 homolog; USE1-like protein; protein p31; putative MAPK activating protein PM26; putative MAPK-activating protein PM26
UniProt Protein Name
Vesicle transport protein USE1
Protein Family
UniProt Gene Name
USE1
UniProt Synonym Gene Names
USE1L
UniProt Entry Name
USE1_HUMAN

Uniprot Description

USE1L: SNARE that may be involved in targeting and fusion of Golgi-derived retrograde transport vesicles with the ER. Belongs to the USE1 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Vesicle

Chromosomal Location of Human Ortholog: 19p13.11

Cellular Component: endoplasmic reticulum membrane; endoplasmic reticulum; lysosome; integral to membrane

Molecular Function: protein binding

Biological Process: lysosomal transport; ER to Golgi vesicle-mediated transport; protein transport; protein catabolic process; secretion by cell

Research Articles on USE1

Similar Products

Product Notes

The USE1 use1 (Catalog #AAA6398134) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The USE1 (Vesicle Transport Protein USE1, MDS032, p31, Putative MAPK-activating Protein PM26, SLT1, USE1-like Protein, USE1L) (MaxLight 490) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's USE1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the USE1 use1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "USE1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.