Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human, Mouse TFAM Polyclonal Antibody | anti-TFAM antibody

TFAM (TCF6, TCF6L2, Transcription Factor A, Mitochondrial, Mitochondrial Transcription Factor 1, Transcription Factor 6, Transcription Factor 6-like 2, TCF-6, MtTF1, mtTFA) (MaxLight 750)

Gene Names
TFAM; TCF6; MTTF1; MTTFA; TCF6L1; TCF6L2; TCF6L3
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TFAM; Polyclonal Antibody; TFAM (TCF6; TCF6L2; Transcription Factor A; Mitochondrial; Mitochondrial Transcription Factor 1; Transcription Factor 6; Transcription Factor 6-like 2; TCF-6; MtTF1; mtTFA) (MaxLight 750); anti-TFAM antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human TFAM. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Applicable Applications for anti-TFAM antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human TFAM, aa1-246 (NP_003192.1).
Immunogen Sequence
MAFLRSMWGVLSALGRSGAELCTGCGSRLRSPFSFVYLPRWFSSVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIKKQRKYGAEEC
Conjugate
MaxLight750
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-TFAM antibody
This gene encodes a mitochondrial transcription factor that is a key activator of mitochondrial transcription as well as a participant in mitochondrial genome replication. Studies in mice have demonstrated that this gene product is required to regulate the mitochondrial genome copy number and is essential for embryonic development. A mouse model for Kearns-Sayre syndrome was produced when expression of this gene was eliminated by targeted disruption in heart and muscle cells.
Product Categories/Family for anti-TFAM antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29,097 Da
NCBI Official Full Name
transcription factor A, mitochondrial isoform 1
NCBI Official Synonym Full Names
transcription factor A, mitochondrial
NCBI Official Symbol
TFAM
NCBI Official Synonym Symbols
TCF6; MTTF1; MTTFA; TCF6L1; TCF6L2; TCF6L3
NCBI Protein Information
transcription factor A, mitochondrial; transcription factor 6; transcription factor 6-like 1; transcription factor 6-like 3; mitochondrial transcription factor 1; mitochondrial transcription factor A; transcription factor 6-like 2 (mitochondrial transcrip
UniProt Protein Name
Transcription factor A, mitochondrial
Protein Family
UniProt Gene Name
TFAM
UniProt Synonym Gene Names
TCF6; TCF6L2; mtTFA; MtTF1; TCF-6
UniProt Entry Name
TFAM_HUMAN

NCBI Description

This gene encodes a key mitochondrial transcription factor containing two high mobility group motifs. The encoded protein also functions in mitochondrial DNA replication and repair. Sequence polymorphisms in this gene are associated with Alzheimer's and Parkinson's diseases. There are pseudogenes for this gene on chromosomes 6, 7, and 11. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012]

Uniprot Description

TFAM: regulates mitochondrial transcription. Induced in humans by caloric restriction. Required for accurate and efficient promoter recognition by the mitochondrial RNA polymerase. Activates transcription by binding immediately upstream of transcriptional start sites. Is able to unwind and bend DNA. Involved in cisplatin resistance. Interacts with TFB1M and TFB2M.

Protein type: Transcription regulation; DNA-binding

Chromosomal Location of Human Ortholog: 10q21

Cellular Component: mitochondrion; mitochondrial matrix; cytosol; nucleus

Molecular Function: protein binding; heat shock protein binding; chromatin binding; DNA bending activity; transcription factor activity

Biological Process: mitochondrial respiratory chain complex assembly; chromatin remodeling; mitochondrion organization and biogenesis; regulation of transcription from RNA polymerase I promoter; organelle organization and biogenesis; positive regulation of transcription, DNA-dependent; positive regulation of transcription from RNA polymerase II promoter; gene expression; DNA-dependent DNA replication; transcription from mitochondrial promoter; transcription initiation from mitochondrial promoter

Research Articles on TFAM

Similar Products

Product Notes

The TFAM tfam (Catalog #AAA6396311) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TFAM (TCF6, TCF6L2, Transcription Factor A, Mitochondrial, Mitochondrial Transcription Factor 1, Transcription Factor 6, Transcription Factor 6-like 2, TCF-6, MtTF1, mtTFA) (MaxLight 750) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's TFAM can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TFAM tfam for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TFAM, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.