Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Rabbit anti-Human TDO Polyclonal Antibody | anti-TDO antibody

TDO (TPH2, TRPO, TDO2, Typtophan 2,3-dioxygenase, Tryptophanase, Typtophan Oxygenase, Tryptophan Pyrrolase, TO) (AP)

Gene Names
TDO2; TO; TDO; TPH2; TRPO
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
TDO; Polyclonal Antibody; TDO (TPH2; TRPO; TDO2; Typtophan 2; 3-dioxygenase; Tryptophanase; Typtophan Oxygenase; Tryptophan Pyrrolase; TO) (AP); anti-TDO antibody
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human TDO2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-TDO antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human TDO2, aa1-406 (NP_005642.1).
Immunogen Sequence
MSGCPFLGNNFGYTFKKLPVEGSEEDKSQTGVNRASKGGLIYGNYLHLEKVLNAQELQSETKGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSVILKLLVQQFSILETMTALDFNDFREYLSPASGFQSLQFRLLENKIGVLQNMRVPYNRRHYRDNFKGEENELLLKSEQEKTLLELVEAWLERTPGLEPHGFNFWGKLEKNITRGLEEEFIRIQAKEESEEKEEQVAEFQKQKEVLLSLFDEKRHEHLLSKGERRLSYRALQGALMIYFYREEPRFQVPFQLLTSLMDIDSLMTKWRYNHVCMVHRMLGSKAGTGGSSGYHYLRSTVSDRYKVFVDLFNLSTYLIPRHWIPKMNPTIHKFLYTAEYCDSSYFSSDESD
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(TDO2 rabbit polyclonal antibody. Western Blot analysis of TDO2 expression in Jurkat.)

Western Blot (WB)

(Western Blot analysis of TDO2 expression in transfected 293T cell line by TDO2 polyclonal antibody. Lane 1: TDO2 transfected lysate (47.9kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-TDO antibody
TDO incorporates oxygen into the indole moiety of tryptophan. Has a broad specificity towards tryptamine and derivatives including D-and L-tryptophan, 5-hydroxytryptophan and serotonin.
Product Categories/Family for anti-TDO antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47,872 Da
NCBI Official Full Name
tryptophan 2,3-dioxygenase
NCBI Official Synonym Full Names
tryptophan 2,3-dioxygenase
NCBI Official Symbol
TDO2
NCBI Official Synonym Symbols
TO; TDO; TPH2; TRPO
NCBI Protein Information
tryptophan 2,3-dioxygenase; TDO; TDO2; TO; TRPO; tryptamin 2,3-dioxygenase; tryptophan oxygenase; tryptophan pyrrolase; tryptophanase
UniProt Protein Name
Tryptophan 2,3-dioxygenase
UniProt Gene Name
TDO2
UniProt Entry Name
T23O_HUMAN

NCBI Description

This gene encodes a heme enzyme that plays a critical role in tryptophan metabolism by catalyzing the first and rate-limiting step of the kynurenine pathway. Increased activity of the encoded protein and subsequent kynurenine production may also play a role in cancer through the suppression of antitumor immune responses, and single nucleotide polymorphisms in this gene may be associated with autism. [provided by RefSeq, Feb 2012]

Uniprot Description

TDO2: Incorporates oxygen into the indole moiety of tryptophan. Has a broad specificity towards tryptamine and derivatives including D- and L-tryptophan, 5-hydroxytryptophan and serotonin. Belongs to the tryptophan 2,3-dioxygenase family.

Protein type: Amino Acid Metabolism - tryptophan; EC 1.13.11.11; Oxidoreductase

Chromosomal Location of Human Ortholog: 4q31-q32

Cellular Component: cytosol

Molecular Function: amino acid binding; metal ion binding; heme binding; oxygen binding; tryptophan 2,3-dioxygenase activity

Biological Process: tryptophan catabolic process to acetyl-CoA; tryptophan catabolic process to kynurenine; tryptophan catabolic process

Research Articles on TDO

Similar Products

Product Notes

The TDO tdo2 (Catalog #AAA6396247) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TDO (TPH2, TRPO, TDO2, Typtophan 2,3-dioxygenase, Tryptophanase, Typtophan Oxygenase, Tryptophan Pyrrolase, TO) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TDO can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TDO tdo2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TDO, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual