Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human SMAD3 Polyclonal Antibody | anti-SMAD3 antibody

SMAD3 (Mothers Against Decapentaplegic Homolog 3, SMAD 3, Mothers Against DPP Homolog 3, MAD Homolog 3, Mad3, hMAD-3, SMAD Family Member 3, JV15-2, hSMAD3, MADH3, DKFZp586N0721, DKFZp686J10186, HSPC193, HsT17436, MGC60396) (MaxLight 650)

Gene Names
SMAD3; LDS3; LDS1C; MADH3; JV15-2; HSPC193; HsT17436
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SMAD3; Polyclonal Antibody; SMAD3 (Mothers Against Decapentaplegic Homolog 3; SMAD 3; Mothers Against DPP Homolog 3; MAD Homolog 3; Mad3; hMAD-3; SMAD Family Member 3; JV15-2; hSMAD3; MADH3; DKFZp586N0721; DKFZp686J10186; HSPC193; HsT17436; MGC60396) (MaxLight 650); anti-SMAD3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human SMAD3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-SMAD3 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human SMAD3, aa31-141.
Immunogen Sequence
ELRLHHSFVLTGDVGRRICRLLVGLFTKGDTSSKRVHPFSPGPCFLLCDLARVGSSPKINVSPFYQNQTSTQRSCTVFVWQRCSLVGPFQVTVFTMYFHHSLRSISRFSSG
Conjugate
MaxLight650
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-SMAD3 antibody
SMAD3, a transcriptional regulator, is activated by TGF-beta and Activin 1 receptor kinase. SMAD3 recognizes an 8 bp palindromic sequence GTCTAGAC. Upon phosphorylation at two extreme C-terminal serines, SMAD3 is translocated into the nucleus where is forms complexes other SMAD proteins, depending on the activation pathway, and regulates the transcription of target genes.
Product Categories/Family for anti-SMAD3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
25,722 Da
NCBI Official Full Name
Homo sapiens SMAD family member 3, mRNA
NCBI Official Synonym Full Names
SMAD family member 3
NCBI Official Symbol
SMAD3
NCBI Official Synonym Symbols
LDS3; LDS1C; MADH3; JV15-2; HSPC193; HsT17436
NCBI Protein Information
mothers against decapentaplegic homolog 3

NCBI Description

The protein encoded by this gene belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene 'mothers against decapentaplegic' (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein functions as a transcriptional modulator activated by transforming growth factor-beta and is thought to play a role in the regulation of carcinogenesis. [provided by RefSeq, Apr 2009]

Research Articles on SMAD3

Similar Products

Product Notes

The SMAD3 (Catalog #AAA6394440) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SMAD3 (Mothers Against Decapentaplegic Homolog 3, SMAD 3, Mothers Against DPP Homolog 3, MAD Homolog 3, Mad3, hMAD-3, SMAD Family Member 3, JV15-2, hSMAD3, MADH3, DKFZp586N0721, DKFZp686J10186, HSPC193, HsT17436, MGC60396) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SMAD3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SMAD3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SMAD3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.