Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (SLC45A2 rabbit polyclonal antibody. Western Blot analysis of SLC45A2 expression in HeLa.)

Rabbit anti-Human SLC45A2 Polyclonal Antibody | anti-SLC45A2 antibody

SLC45A2 (Solute Carrier Family 45 Member 2, 1A1, AIM1, Membrane-associated Transporter Protein, MATP, Melanoma Antigen AIM1, Protein AIM-1, SHEP5) (PE)

Gene Names
SLC45A2; 1A1; AIM1; MATP; OCA4; SHEP5
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SLC45A2; Polyclonal Antibody; SLC45A2 (Solute Carrier Family 45 Member 2; 1A1; AIM1; Membrane-associated Transporter Protein; MATP; Melanoma Antigen AIM1; Protein AIM-1; SHEP5) (PE); anti-SLC45A2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human SLC45A2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-SLC45A2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human SLC45A2, aa1-460 (NP_001012527.1).
Immunogen Sequence
MGSNSGQAGRHIYKSLADDGPFDSVEPPKRPTSRLIMHSMAMFGREFCYAVEAAYVTPVLLSVGLPSSLYSIVWFLSPILGFLLQPVVGSASDHCRSRWGRRRPYILTLGVMMLVGMALYLNGATVVAALIANPRRKLVWAISVTMIGVVLFDFAADFIDGPIKAYLFDVCSHQDKEKGLHYHALFTGFGGALGYLLGAIDWAHLELGRLLGTEFQVMFFFSALVLTLCFTVHLCSISEAPLTEVAKGIPPQQTPQDPPLSSDGMYEYGSIEKVKNGYVNPELAMQGAKNKNHAEQTRRAMTLKSLLRALVNMPPHYRYLCISHLIGWTAFLSNMLFFTDFMGQIVYRGDPYSAHNSTEFLIYERGVEVGCWGFCINSVFSSLYSYFQKVLVSYIGLKGLYFTGYLLFGLGTGFIGLFPNVYSTLVLCSLFGVMSSTLYTVPFNLITEYHREEEKEVCCH
Conjugate
PE
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(SLC45A2 rabbit polyclonal antibody. Western Blot analysis of SLC45A2 expression in HeLa.)

Western Blot (WB) (SLC45A2 rabbit polyclonal antibody. Western Blot analysis of SLC45A2 expression in HeLa.)

Western Blot (WB)

(Western Blot analysis of SLC45A2 expression in transfected 293T cell line by SLC45A2 polyclonal antibody. Lane 1: SLC45A2 transfected lysate (51.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SLC45A2 expression in transfected 293T cell line by SLC45A2 polyclonal antibody. Lane 1: SLC45A2 transfected lysate (51.2kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-SLC45A2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58,268 Da
NCBI Official Full Name
membrane-associated transporter protein isoform b
NCBI Official Synonym Full Names
solute carrier family 45, member 2
NCBI Official Symbol
SLC45A2
NCBI Official Synonym Symbols
1A1; AIM1; MATP; OCA4; SHEP5
NCBI Protein Information
membrane-associated transporter protein; underwhite; protein AIM-1; melanoma antigen AIM1; membrane associated transporter
UniProt Protein Name
Membrane-associated transporter protein
UniProt Gene Name
SLC45A2
UniProt Synonym Gene Names
AIM1; MATP; Protein AIM-1
UniProt Entry Name
S45A2_HUMAN

Uniprot Description

SLC45A2: Melanocyte differentiation antigen. May transport substances required for melanin biosynthesis. Defects in SLC45A2 are the cause of albinism oculocutaneous type 4 (OCA4). A disorder of pigmentation characterized by reduced biosynthesis of melanin in the skin, hair and eyes. Patients show reduced or lacking pigmentation associated with classic albinism ocular abnormalities, including decreased visual acuity, macular hypoplasia, optic dysplasia, atypical choroidal vessels, and nystagmus. Belongs to the glycoside-pentoside-hexuronide (GPH) cation symporter transporter (TC 2.A.2) family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Transporter, SLC family; Membrane protein, integral; Membrane protein, multi-pass; Transporter

Chromosomal Location of Human Ortholog: 5p13.2

Cellular Component: melanosome membrane; integral to membrane

Biological Process: melanin biosynthetic process; visual perception; response to stimulus

Disease: Skin/hair/eye Pigmentation, Variation In, 5; Albinism, Oculocutaneous, Type Iv

Similar Products

Product Notes

The SLC45A2 slc45a2 (Catalog #AAA6394365) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SLC45A2 (Solute Carrier Family 45 Member 2, 1A1, AIM1, Membrane-associated Transporter Protein, MATP, Melanoma Antigen AIM1, Protein AIM-1, SHEP5) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC45A2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SLC45A2 slc45a2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC45A2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.