Rabbit anti-Human SGK2 Polyclonal Antibody | anti-SGK2 antibody

SGK2 (Serine/Threonine-protein Kinase SGK2, Serum/Glucocorticoid-regulated Kinase 2) (AP)

Cat. Num. AAA6394003

• Gene Names: SGK2; H-SGK2; dJ138B7.2
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SGK2; Polyclonal Antibody; SGK2 (Serine/Threonine-protein Kinase SGK2; Serum/Glucocorticoid-regulated Kinase 2) (AP); anti-SGK2 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human SGK2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-SGK2 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human SGK2, aa1-367 (NP_733794.1).
• Immunogen Sequence: MNSSPAGTPSPQPSRANGNINLGPSANPNAQPTDFDFLKVIGKGNYGKVLLAKRKSDGAFYAVKVLQKKSILKKKEQSHIMAERSVLLKNVRHPFLVGLRYSFQTPEKLYFVLDYVNGGELFFHLQRERRFLEPRARFYAAEVASAIGYLHSLNIIYRDLKPENILLDCQGHVVLTDFGLCKEGVEPEDTTSTFCGTPEYLAPEVLRKEPYDRAVDWWCLGAVLYEMLHGLPPFYSQDVSQMYENILHQPLQIPGGRTVAACDLLQSLLHKDQRQRLGSKADFLEIKNHVFFSPINWDDLYHKRLTPPFNPNVTGPADLKHFDPEFTQEAVSKSIGCTPDTVASSSGASSAFLGFSYAPEDDDILDC
• Conjugate: AP
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of SGK2 expression in transfected 293T cell line by SGK2 rabbit polyclonal antibody. Lane 1: SGK2 transfected lysate (41.2kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-SGK2 antibody

SGK2, a Ser/Thr protein kinase, is similar to serum-and glucocorticoid-induced protein kinase (SGK), but this gene product is not induced by serum or glucocorticoids. Expression is induced in response to signals that activate phosphatidylinositol 3-kinase, which is also true for SGK.

Product Categories/Family for anti-SGK2 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 25168261
• NCBI GeneID: 10110
• NCBI Accession #: NP_733794.1
• NCBI GenBank Nucleotide #: NM_170693.1
• UniProt Accession #: Q9HBY8; Q52PK5; Q5H8Y6; Q5H8Z1; Q5TZR3; Q9UKG6
• Molecular Weight: 43,977 Da
• NCBI Official Full Name: serine/threonine-protein kinase Sgk2 isoform alpha
• NCBI Official Synonym Full Names: SGK2, serine/threonine kinase 2
• NCBI Official Symbol: SGK2
• NCBI Official Synonym Symbols: H-SGK2; dJ138B7.2
• NCBI Protein Information: serine/threonine-protein kinase Sgk2
• UniProt Protein Name: Serine/threonine-protein kinase Sgk2
• Protein Family: Serine/threonine-protein kinase
• UniProt Gene Name: SGK2
• UniProt Entry Name: SGK2_HUMAN

NCBI Description

This gene encodes a serine/threonine protein kinase. Although this gene product is similar to serum- and glucocorticoid-induced protein kinase (SGK), this gene is not induced by serum or glucocorticoids. This gene is induced in response to signals that activate phosphatidylinositol 3-kinase, which is also true for SGK. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2010]

Uniprot Description

SGK2: Serine/threonine-protein kinase which is involved in the regulation of a wide variety of ion channels, membrane transporters, cell growth, survival and proliferation. Up- regulates Na(+) channels: SCNN1A/ENAC, K(+) channels: KCNA3/Kv1.3, KCNE1 and KCNQ1, amino acid transporter: SLC6A19, glutamate transporter: SLC1A6/EAAT4, glutamate receptors: GRIA1/GLUR1 and GRIK2/GLUR6, Na(+)/H(+) exchanger: SLC9A3/NHE3, and the Na(+)/K(+) ATPase. Highly expressed in liver, kidney and pancreas, and at lower levels in brain. Two specific sites, one in the kinase domain (Thr-253) and the other in the C-terminal regulatory region (Ser- 416), need to be phsphorylated for its full activation. Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Protein kinase, AGC; Kinase, protein; EC 2.7.11.1; Protein kinase, Ser/Thr (non-receptor); AGC group; SGK family

Chromosomal Location of Human Ortholog: 20q13.2

Cellular Component: nucleus; cytosol

Molecular Function: protein serine/threonine kinase activity; potassium channel regulator activity; sodium channel regulator activity; ATP binding

Biological Process: positive regulation of transporter activity; regulation of cell growth; response to oxidative stress; transmembrane transport; protein amino acid phosphorylation; regulation of cell proliferation