Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (SAE1 rabbit polyclonal antibody. Western Blot analysis of SAE1 expression in human liver.)

Rabbit anti-Human SAE1 Polyclonal Antibody | anti-SAE1 antibody

SAE1 (SUMO-activating Enzyme Subunit 1, Ubiquitin-like 1-activating Enzyme E1A, AOS1, SUA1, UBLE1A) (Biotin)

Gene Names
SAE1; AOS1; SUA1; UBLE1A; HSPC140
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SAE1; Polyclonal Antibody; SAE1 (SUMO-activating Enzyme Subunit 1; Ubiquitin-like 1-activating Enzyme E1A; AOS1; SUA1; UBLE1A) (Biotin); anti-SAE1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human SAE1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
2522
Applicable Applications for anti-SAE1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human SAE1, aa1-346 (NP_005491.1).
Immunogen Sequence
MVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQVTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIVKVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTKVAKVSQGVEDGPDTKRAKLDSSETTMVKKKVVFCPVKEALEVDWSSEKAKAALKRTTSDYFLLQVLLKFRTDKGRDPSSDTYEEDSELLLQIRNDVLDSLGISPDLLPEDFVRYCFSEMAPVCAVVGGILAQEIVKALSQRDPPHNNFFFFDGMKGNGIVECLGPK
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(SAE1 rabbit polyclonal antibody. Western Blot analysis of SAE1 expression in human liver.)

Western Blot (WB) (SAE1 rabbit polyclonal antibody. Western Blot analysis of SAE1 expression in human liver.)

Western Blot (WB)

(Western Blot analysis of SAE1 expression in transfected 293T cell line by SAE1 polyclonal antibody. Lane 1: SAE1 transfected lysate (38.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SAE1 expression in transfected 293T cell line by SAE1 polyclonal antibody. Lane 1: SAE1 transfected lysate (38.4kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-SAE1 antibody
The ubiquitin-like protein SUMO-1 is conjugated to a variety of proteins including Ran GTPase-activating protein 1 (RanGAP1), IkappaB alpha, and PML. SUMO-1-modified proteins display altered subcellular targeting and/or stability. SAE1 is capable of catalyzing the ATP-dependent formation of a thioester linkage between SUMO-1 and SAE2.
Product Categories/Family for anti-SAE1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens SUMO1 activating enzyme subunit 1 (SAE1), transcript variant 1, mRNA
NCBI Official Synonym Full Names
SUMO1 activating enzyme subunit 1
NCBI Official Symbol
SAE1
NCBI Official Synonym Symbols
AOS1; SUA1; UBLE1A; HSPC140
NCBI Protein Information
SUMO-activating enzyme subunit 1
UniProt Protein Name
SUMO-activating enzyme subunit 1
Protein Family
UniProt Gene Name
SAE1
UniProt Synonym Gene Names
AOS1; SUA1; UBLE1A
UniProt Entry Name
SAE1_HUMAN

NCBI Description

Posttranslational modification of proteins by the addition of the small protein SUMO (see SUMO1; MIM 601912), or sumoylation, regulates protein structure and intracellular localization. SAE1 and UBA2 (MIM 613295) form a heterodimer that functions as a SUMO-activating enzyme for the sumoylation of proteins (Okuma et al., 1999 [PubMed 9920803]).[supplied by OMIM, Mar 2010]

Uniprot Description

UBLE1A: The heterodimer acts as a E1 ligase for SUMO1, SUMO2, SUMO3, and probably SUMO4. It mediates ATP-dependent activation of SUMO proteins followed by formation of a thioester bond between a SUMO protein and a conserved active site cysteine residue on UBA2/SAE2. Belongs to the ubiquitin-activating E1 family.

Protein type: EC 6.3.2.19; Ubiquitin ligase; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 19q13.32

Cellular Component: nucleoplasm; intracellular membrane-bound organelle; cytosol; nucleus

Molecular Function: protein C-terminus binding; ATP-dependent protein binding; SUMO activating enzyme activity; protein binding; protein heterodimerization activity; enzyme activator activity; ubiquitin activating enzyme activity

Biological Process: positive regulation of catalytic activity; cellular protein metabolic process; protein sumoylation; regulation of mitotic cell cycle; protein ubiquitination; SMT3-dependent protein catabolic process; post-translational protein modification

Research Articles on SAE1

Similar Products

Product Notes

The SAE1 sae1 (Catalog #AAA6393246) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SAE1 (SUMO-activating Enzyme Subunit 1, Ubiquitin-like 1-activating Enzyme E1A, AOS1, SUA1, UBLE1A) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SAE1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SAE1 sae1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SAE1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.