Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of RTN3 expression in transfected 293T cell line by 132880. Lane 1: RTN3 transfected lysate (25.6kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human RTN3 Polyclonal Antibody | anti-RTN3 antibody

RTN3 (Reticulon-3, Neuroendocrine-specific Protein-like 2, NSP-like Protein 2, Neuroendocrine-specific Protein-like II, NSP-like Protein II, NSPLII, ASYIP, NSPL2) (PE)

Gene Names
RTN3; HAP; ASYIP; NSPL2; NSPLII; RTN3-A1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RTN3; Polyclonal Antibody; RTN3 (Reticulon-3; Neuroendocrine-specific Protein-like 2; NSP-like Protein 2; Neuroendocrine-specific Protein-like II; NSP-like Protein II; NSPLII; ASYIP; NSPL2) (PE); anti-RTN3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human RTN3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-RTN3 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full-length recombinant protein corresponding to aa1-236 from human RTN3.
Immunogen Sequence
MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAVHDLIFWRDVKKTGFVFGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRIYKSVIQAVQKSEEGHPFKAYLDVDITLSSEAFHNYMNAAMVHINRALKLIIRLFLVEDLVDSLKLAVFMWLMTYVGAVFNGITLLILAELLIFSVPIVYEKYKTQIDHYVGIARDQTKSIVEKIQAKLPGIAKKKAE
Conjugate
PE
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of RTN3 expression in transfected 293T cell line by 132880. Lane 1: RTN3 transfected lysate (25.6kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of RTN3 expression in transfected 293T cell line by 132880. Lane 1: RTN3 transfected lysate (25.6kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-RTN3 antibody
May be involved in membrane trafficking in the early secretory pathway. Inhibits BACE1 activity and amyloid precursor protein processing. May induce caspase-8 cascade and apoptosis. May favor BCL2 translocation to the mitochondria upon endoplasmic reticulum stress. In case of enteroviruses infection, RTN3 may be involved in the viral replication or pathogenesis.
Product Categories/Family for anti-RTN3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
100,824 Da
NCBI Official Full Name
reticulon-3 isoform a
NCBI Official Synonym Full Names
reticulon 3
NCBI Official Symbol
RTN3
NCBI Official Synonym Symbols
HAP; ASYIP; NSPL2; NSPLII; RTN3-A1
NCBI Protein Information
reticulon-3; NSP-like protein 2; NSP-like protein II; homolog of ASY protein; ASY interacting protein; neuroendocrine-specific protein-like 2; neuroendocrine-specific protein-like II
UniProt Protein Name
Reticulon-3
Protein Family
UniProt Gene Name
RTN3
UniProt Synonym Gene Names
ASYIP; NSPL2; HAP; NSP-like protein 2; NSP-like protein II; NSPLII
UniProt Entry Name
RTN3_HUMAN

NCBI Description

This gene belongs to the reticulon family of highly conserved genes that are preferentially expressed in neuroendocrine tissues. This family of proteins interact with, and modulate the activity of beta-amyloid converting enzyme 1 (BACE1), and the production of amyloid-beta. An increase in the expression of any reticulon protein substantially reduces the production of amyloid-beta, suggesting that reticulon proteins are negative modulators of BACE1 in cells. Alternatively spliced transcript variants encoding different isoforms have been found for this gene, and pseudogenes of this gene are located on chromosomes 4 and 12. [provided by RefSeq, May 2012]

Uniprot Description

RTN3: May be involved in membrane trafficking in the early secretory pathway. Inhibits BACE1 activity and amyloid precursor protein processing. May induce caspase-8 cascade and apoptosis. May favor BCL2 translocation to the mitochondria upon endoplasmic reticulum stress. In case of enteroviruses infection, RTN3 may be involved in the viral replication or pathogenesis. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Endoplasmic reticulum; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 11q13

Cellular Component: Golgi membrane; extracellular space; endoplasmic reticulum membrane; endoplasmic reticulum; integral to membrane

Biological Process: vesicle-mediated transport; viral reproduction; apoptosis

Research Articles on RTN3

Similar Products

Product Notes

The RTN3 rtn3 (Catalog #AAA6393078) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RTN3 (Reticulon-3, Neuroendocrine-specific Protein-like 2, NSP-like Protein 2, Neuroendocrine-specific Protein-like II, NSP-like Protein II, NSPLII, ASYIP, NSPL2) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RTN3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RTN3 rtn3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RTN3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.