Rabbit anti-Human RTN3 Polyclonal Antibody | anti-RTN3 antibody

RTN3 (Reticulon-3, Neuroendocrine-specific Protein-like 2, NSP-like Protein 2, Neuroendocrine-specific Protein-like II, NSP-like Protein II, NSPLII, ASYIP, NSPL2) (AP)

Cat. Num. AAA6393068

• Gene Names: RTN3; HAP; ASYIP; NSPL2; NSPLII; RTN3-A1
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: RTN3; Polyclonal Antibody; RTN3 (Reticulon-3; Neuroendocrine-specific Protein-like 2; NSP-like Protein 2; Neuroendocrine-specific Protein-like II; NSP-like Protein II; NSPLII; ASYIP; NSPL2) (AP); anti-RTN3 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human RTN3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-RTN3 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full-length recombinant protein corresponding to aa1-236 from human RTN3.
• Immunogen Sequence: MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAVHDLIFWRDVKKTGFVFGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRIYKSVIQAVQKSEEGHPFKAYLDVDITLSSEAFHNYMNAAMVHINRALKLIIRLFLVEDLVDSLKLAVFMWLMTYVGAVFNGITLLILAELLIFSVPIVYEKYKTQIDHYVGIARDQTKSIVEKIQAKLPGIAKKKAE
• Conjugate: AP
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of RTN3 expression in transfected 293T cell line by 132880. Lane 1: RTN3 transfected lysate (25.6kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-RTN3 antibody

May be involved in membrane trafficking in the early secretory pathway. Inhibits BACE1 activity and amyloid precursor protein processing. May induce caspase-8 cascade and apoptosis. May favor BCL2 translocation to the mitochondria upon endoplasmic reticulum stress. In case of enteroviruses infection, RTN3 may be involved in the viral replication or pathogenesis.

Product Categories/Family for anti-RTN3 antibody

Antibodies; Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 5174655
• NCBI GeneID: 10313
• NCBI Accession #: NP_006045.1
• NCBI GenBank Nucleotide #: NM_006054.2
• UniProt Accession #: O95197; Q147U9; Q496K2; Q53GN3; Q59EP0; Q5UEP2; Q6T930; Q7RTM7; B3KQS2; B7Z308; B7Z4M0; F5H774
• Molecular Weight: 100,824 Da
• NCBI Official Full Name: reticulon-3 isoform a
• NCBI Official Synonym Full Names: reticulon 3
• NCBI Official Symbol: RTN3
• NCBI Official Synonym Symbols: HAP; ASYIP; NSPL2; NSPLII; RTN3-A1
• NCBI Protein Information: reticulon-3; NSP-like protein 2; NSP-like protein II; homolog of ASY protein; ASY interacting protein; neuroendocrine-specific protein-like 2; neuroendocrine-specific protein-like II
• UniProt Protein Name: Reticulon-3
• Protein Family: Reticulon
• UniProt Gene Name: RTN3
• UniProt Synonym Gene Names: ASYIP; NSPL2; HAP; NSP-like protein 2; NSP-like protein II; NSPLII
• UniProt Entry Name: RTN3_HUMAN

NCBI Description

This gene belongs to the reticulon family of highly conserved genes that are preferentially expressed in neuroendocrine tissues. This family of proteins interact with, and modulate the activity of beta-amyloid converting enzyme 1 (BACE1), and the production of amyloid-beta. An increase in the expression of any reticulon protein substantially reduces the production of amyloid-beta, suggesting that reticulon proteins are negative modulators of BACE1 in cells. Alternatively spliced transcript variants encoding different isoforms have been found for this gene, and pseudogenes of this gene are located on chromosomes 4 and 12. [provided by RefSeq, May 2012]

Uniprot Description

RTN3: May be involved in membrane trafficking in the early secretory pathway. Inhibits BACE1 activity and amyloid precursor protein processing. May induce caspase-8 cascade and apoptosis. May favor BCL2 translocation to the mitochondria upon endoplasmic reticulum stress. In case of enteroviruses infection, RTN3 may be involved in the viral replication or pathogenesis. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Endoplasmic reticulum; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 11q13

Cellular Component: Golgi membrane; extracellular space; endoplasmic reticulum membrane; endoplasmic reticulum; integral to membrane

Biological Process: vesicle-mediated transport; viral reproduction; apoptosis