Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of RHOA expression in transfected 293T cell line by RHOA polyclonal antibody. Lane 1: RHOA transfected lysate (21.8kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human RHOA Polyclonal Antibody | anti-RHOA antibody

RHOA (Transforming Protein RhoA, Rho cDNA Clone 12, h12, ARH12, ARHA, RHO12) (PE)

Gene Names
RHOA; ARHA; ARH12; RHO12; EDFAOB; RHOH12
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RHOA; Polyclonal Antibody; RHOA (Transforming Protein RhoA; Rho cDNA Clone 12; h12; ARH12; ARHA; RHO12) (PE); anti-RHOA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human RHOA.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
193
Applicable Applications for anti-RHOA antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human RHOA, aa1-193 (AAH01360.1).
Immunogen Sequence
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL
Conjugate
PE
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of RHOA expression in transfected 293T cell line by RHOA polyclonal antibody. Lane 1: RHOA transfected lysate (21.8kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of RHOA expression in transfected 293T cell line by RHOA polyclonal antibody. Lane 1: RHOA transfected lysate (21.8kD). Lane 2: Non-transfected lysate.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between RHOA and DAAM1 HeLa cells were stained with RHOA rabbit purified polyclonal 1:1200 and DAAM1 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between RHOA and DAAM1 HeLa cells were stained with RHOA rabbit purified polyclonal 1:1200 and DAAM1 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Related Product Information for anti-RHOA antibody
RHOA regulates a signal transduction pathway linking plasma membrane receptors to the assembly of focal adhesions and actin stress fibers. Serves as a target for the yopT cysteine peptidase from Yersinia pestis, vector of the plague, and Yersinia pseudotuberculosis, which causes gastrointestinal disorders. May be an activator of PLCE1. Activated by ARHGEF2, which promotes the exchange of GDP for GTP.
Product Categories/Family for anti-RHOA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
387
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Ras homolog gene family, member A
NCBI Official Synonym Full Names
ras homolog family member A
NCBI Official Symbol
RHOA
NCBI Official Synonym Symbols
ARHA; ARH12; RHO12; EDFAOB; RHOH12
NCBI Protein Information
transforming protein RhoA
UniProt Protein Name
Transforming protein RhoA
Protein Family
UniProt Gene Name
RHOA
UniProt Synonym Gene Names
ARH12; ARHA; RHO12; h12
UniProt Entry Name
RHOA_HUMAN

NCBI Description

This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants have been identified. [provided by RefSeq, Sep 2015]

Uniprot Description

RHOA: a small G protein of the Rho family. Regulates a signal transduction pathway linking plasma membrane receptors to the assembly of focal adhesions and actin stress fibers. Controls the reorganization of actins into podosomes. Serves as a target for the yopT cysteine peptidase from Yersinia pestis, vector of the plague, and Yersinia pseudotuberculosis, which causes gastrointestinal disorders.

Protein type: G protein, monomeric, Rho; G protein, monomeric; Motility/polarity/chemotaxis; Oncoprotein; G protein

Chromosomal Location of Human Ortholog: 3p21.3

Cellular Component: apical junction complex; focal adhesion; cytoskeleton; lamellipodium; plasma membrane; cell cortex; midbody; cytosol; cell junction; cleavage furrow

Molecular Function: GTPase activity; protein binding; myosin binding; GTP binding

Biological Process: axon guidance; nerve growth factor receptor signaling pathway; viral reproduction; metabolic process; negative chemotaxis; positive regulation of NF-kappaB import into nucleus; regulation of axonogenesis; regulation of cell migration; Rho protein signal transduction; regulation of osteoblast proliferation; substantia nigra development; transforming growth factor beta receptor signaling pathway; small GTPase mediated signal transduction; positive regulation of stress fiber formation; ephrin receptor signaling pathway; negative regulation of axonogenesis; positive regulation of cytokinesis; platelet activation; positive regulation of I-kappaB kinase/NF-kappaB cascade; phosphoinositide-mediated signaling; apical junction assembly; regulation of small GTPase mediated signal transduction; positive regulation of axonogenesis; actin cytoskeleton organization and biogenesis; positive regulation of neuron differentiation; vascular endothelial growth factor receptor signaling pathway; blood coagulation

Research Articles on RHOA

Similar Products

Product Notes

The RHOA rhoa (Catalog #AAA6392517) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RHOA (Transforming Protein RhoA, Rho cDNA Clone 12, h12, ARH12, ARHA, RHO12) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RHOA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RHOA rhoa for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RHOA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.