Rabbit anti-Human RAD54B Polyclonal Antibody | anti-RAD54B antibody

RAD54B (DNA Replication, Repair and Recombination Factor) (PE)

Cat. Num. AAA6391901

• Gene Names: RAD54B; RDH54
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: RAD54B; Polyclonal Antibody; RAD54B (DNA Replication; Repair and Recombination Factor) (PE); anti-RAD54B antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human RAD54B.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-RAD54B antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human RAD54B, aa1-158 (AAH33710.2).
• Immunogen Sequence: MLDHHPVAITVEVKQEEDIKPPPPLVLNSQQSDTLEQREEHELVHVMERSLSPSLSSVDMRMTSSPSSIPRRDDFFRHESGEHFRSLLGYDPQILQMLKEEHQIILENQKNFGLYVQEKRDGLKRRQQLEEELLRAKIEVEKLKAIRLRHDLPEYNSL
• Conjugate: PE
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(RAD54B rabbit polyclonal antibody. Western Blot analysis of RAD54B expression in human stomach.)

Western Blot (WB)

(Western Blot analysis of RAD54B expression in transfected 293T cell line by RAD54B polyclonal antibody. Lane 1: RAD54B transfected lysate (18.6kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-RAD54B antibody

The protein encoded by this gene belongs to the DEAD-like helicase superfamily. It shares similarity with Saccharomyces cerevisiae RAD54 and RDH54, both of which are involved in homologous recombination and repair of DNA. This protein binds to double-stranded DNA, and displays ATPase activity in the presence of DNA. This gene is highly expressed in testis and spleen, which suggests active roles in meiotic and mitotic recombination. Homozygous mutations of this gene were observed in primary lymphoma and colon cancer. [provided by RefSeq]

Product Categories/Family for anti-RAD54B antibody

Antibodies; DNA Replication; Repair

NCBI and Uniprot Product Information

• NCBI GI #: 34193975
• NCBI GeneID: 25788
• Molecular Weight: 13,330 Da
• NCBI Official Full Name: Homo sapiens RAD54 homolog B (S. cerevisiae), mRNA
• NCBI Official Synonym Full Names: RAD54 homolog B (S. cerevisiae)
• NCBI Official Symbol: RAD54B
• NCBI Official Synonym Symbols: RDH54
• NCBI Protein Information: DNA repair and recombination protein RAD54B
• Protein Family: DNA repair and recombination protein

NCBI Description

The protein encoded by this gene belongs to the DEAD-like helicase superfamily. It shares similarity with Saccharomyces cerevisiae RAD54 and RDH54, both of which are involved in homologous recombination and repair of DNA. This protein binds to double-stranded DNA, and displays ATPase activity in the presence of DNA. This gene is highly expressed in testis and spleen, which suggests active roles in meiotic and mitotic recombination. Homozygous mutations of this gene were observed in primary lymphoma and colon cancer. [provided by RefSeq, Jul 2008]