Rabbit anti-Human POLR3K Polyclonal Antibody | anti-POLR3K antibody

POLR3K (DNA-directed RNA Polymerase III Subunit RPC10, RNA Polymerase III Subunit C10, DNA-directed RNA Polymerase III Subunit K, RNA Polymerase III 12.5kD Subunit, RPC12.5, RNA Polymerase III Subunit C11, HsC11p, RPC11, hRPC11, My010, C11-RNP3, RPC12.5)

Cat. Num. AAA6390188

• Gene Names: POLR3K; C11; My010; RPC10; RPC11; RPC12.5; C11-RNP3
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: POLR3K; Polyclonal Antibody; POLR3K (DNA-directed RNA Polymerase III Subunit RPC10; RNA Polymerase III Subunit C10; DNA-directed RNA Polymerase III Subunit K; RNA Polymerase III 12.5kD Subunit; RPC12.5; RNA Polymerase III Subunit C11; HsC11p; RPC11; hRPC11; My010; C11-RNP3; RPC12.5); anti-POLR3K antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human POLR3K.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-POLR3K antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human POLR3K, aa1-108 (NP_057394.1).
• Immunogen Sequence: MLLFCPGCGNGLIVEEGQRCHRFACNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD
• Conjugate: Biotin
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of POLR3K expression in transfected 293T cell line by POLR3K polyclonal antibody. Lane 1: POLR3K transfected lysate (12.3kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-POLR3K antibody

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. Plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts, such as Epstein-Barr virus-encoded RNAs (EBERs) induce type I interferon and NF-Kappa-B through the RIG-I pathway.

Product Categories/Family for anti-POLR3K antibody

Antibodies; Enzymes; Polymerase

NCBI and Uniprot Product Information

• NCBI GI #: 7706499
• NCBI GeneID: 51728
• NCBI Accession #: NP_057394.1
• NCBI GenBank Nucleotide #: NM_016310.2
• Molecular Weight: 14.7kDa (131aa)
• NCBI Official Full Name: DNA-directed RNA polymerase III subunit RPC10
• NCBI Official Synonym Full Names: RNA polymerase III subunit K
• NCBI Official Symbol: POLR3K
• NCBI Official Synonym Symbols: C11; My010; RPC10; RPC11; RPC12.5; C11-RNP3
• NCBI Protein Information: DNA-directed RNA polymerase III subunit RPC10
• Protein Family: DNA-directed RNA polymerase

NCBI Description

This gene encodes a small essential subunit of RNA polymerase III, the polymerase responsible for synthesizing transfer and small ribosomal RNAs in eukaryotes. The carboxy-terminal domain of this subunit shares a high degree of sequence similarity to the carboxy-terminal domain of an RNA polymerase II elongation factor. This similarity in sequence is supported by functional studies showing that this subunit is required for proper pausing and termination during transcription. Pseudogenes of this gene are found on chromosomes 13 and 17.[provided by RefSeq, Jul 2010]