DNA-directed RNA polymerase III subunit RPC10 Recombinant Protein | POLR3K recombinant protein

Recombinant Human DNA-directed RNA polymerase III subunit RPC10

Cat. Num. AAA969596

• Gene Names: POLR3K; C11; My010; RPC10; RPC11; RPC12.5; C11-RNP3
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: DNA-directed RNA polymerase III subunit RPC10; Recombinant Human DNA-directed RNA polymerase III subunit RPC10; DNA-directed RNA polymerase III subunit KRNA polymerase III 12.5 kDa subunit; RPC12.5RNA polymerase III subunit C11; HsC11p; RPC11; hRPC11; POLR3K recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-108aa; Full Length
• Sequence: MLLFCPGCGNGLIVEEGQRCHRFSCNTCPYVHNITRKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCPKCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHRWRD
• Sequence Length: 108

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for POLR3K recombinant protein

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. Plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts, such as Epstein-Barr virus-encoded RNAs (EBERs) induce type I interferon and NF- Kappa-B through the RIG-I pathway.

Product Categories/Family for POLR3K recombinant protein

Immunology

References

The RNA cleavage activity of RNA polymerase III is mediated by an essential TFIIS-like subunit and is important for transcription termination.Chedin S., Riva M., Schultz P., Sentenac A., Carles C.Genes Dev. 12:3857-3871(1998) Molecular identification and characteristics of hRPC11, the smallest specific subunit of human RNA polymerase III.Spakovskii G.V., Lebedenko E.N.Bioorg. Khim. 24:877-880(1998) Mao Y.M., Xie Y., Zheng Z.H., Gu S.H., Ying K., Lin Q., Dai J.L., Tang R., Dong H., Wu X.Z. A regulatory SNP causes a human genetic disease by creating a new transcriptional promoter.De Gobbi M., Viprakasit V., Hughes J.R., Fisher C., Buckle V.J., Ayyub H., Gibbons R.J., Vernimmen D., Yoshinaga Y., de Jong P., Cheng J.-F., Rubin E.M., Wood W.G., Bowden D., Higgs D.R.Science 312:1215-1217(2006) Sequence, structure and pathology of the fully annotated terminal 2 Mb of the short arm of human chromosome 16.Daniels R.J., Peden J.F., Lloyd C., Horsley S.W., Clark K., Tufarelli C., Kearney L., Buckle V.J., Doggett N.A., Flint J., Higgs D.R.Hum. Mol. Genet. 10:339-352(2001) The sequence and analysis of duplication-rich human chromosome 16.Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J., Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.Nature 432:988-994(2004) Characterization of human RNA polymerase III identifies orthologues for Saccharomyces cerevisiae RNA polymerase III subunits.Hu P., Wu S., Sun Y., Yuan C.-C., Kobayashi R., Myers M.P., Hernandez N.Mol. Cell. Biol. 22:8044-8055(2002) RNA polymerase III detects cytosolic DNA and induces type I interferons through the RIG-I pathway.Chiu Y.-H., Macmillan J.B., Chen Z.J.Cell 138:576-591(2009) RIG-I-dependent sensing of poly(dA:dT) through the induction of an RNA polymerase III-transcribed RNA intermediate.Ablasser A., Bauernfeind F., Hartmann G., Latz E., Fitzgerald K.A., Hornung V.Nat. Immunol. 10:1065-1072(2009) Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011)

NCBI and Uniprot Product Information

• NCBI GI #: 597709807
• NCBI GeneID: 51728
• NCBI Accession #: NP_057394.3
• NCBI GenBank Nucleotide #: NM_016310.4
• UniProt Accession #: Q9Y2Y1; Q1W6H4; Q96S35
• Molecular Weight: 28.3 kDa
• NCBI Official Full Name: DNA-directed RNA polymerase III subunit RPC10
• NCBI Official Synonym Full Names: polymerase (RNA) III (DNA directed) polypeptide K, 12.3 kDa
• NCBI Official Symbol: POLR3K
• NCBI Official Synonym Symbols: C11; My010; RPC10; RPC11; RPC12.5; C11-RNP3
• NCBI Protein Information: DNA-directed RNA polymerase III subunit RPC10
• UniProt Protein Name: DNA-directed RNA polymerase III subunit RPC10
• Protein Family: DNA-directed RNA polymerase
• UniProt Gene Name: POLR3K
• UniProt Synonym Gene Names: RPC11; RNA polymerase III subunit C10; RPC12.5; HsC11p; RPC11; hRPC11
• UniProt Entry Name: RPC10_HUMAN

NCBI Description

This gene encodes a small essential subunit of RNA polymerase III, the polymerase responsible for synthesizing transfer and small ribosomal RNAs in eukaryotes. The carboxy-terminal domain of this subunit shares a high degree of sequence similarity to the carboxy-terminal domain of an RNA polymerase II elongation factor. This similarity in sequence is supported by functional studies showing that this subunit is required for proper pausing and termination during transcription. Pseudogenes of this gene are found on chromosomes 13 and 17.[provided by RefSeq, Jul 2010]

Uniprot Description

POLR3K: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. Plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts, such as Epstein-Barr virus-encoded RNAs (EBERs) induce type I interferon and NF- Kappa-B through the RIG-I pathway. Belongs to the archaeal RpoM/eukaryotic RPA12/RPB9/RPC11 RNA polymerase family.

Protein type: DNA-binding; Transferase; Transcription initiation complex

Chromosomal Location of Human Ortholog: 16p13.3

Cellular Component: cytosol; DNA-directed RNA polymerase III complex; nucleolus; nucleoplasm

Molecular Function: DNA binding; DNA-directed RNA polymerase activity; zinc ion binding

Biological Process: defense response to virus; gene expression; innate immune response; positive regulation of interferon type I production; RNA elongation from RNA polymerase III promoter; termination of RNA polymerase III transcription; transcription from RNA polymerase III promoter