Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Rabbit anti-Human NT5C Polyclonal Antibody | anti-NT5C antibody

NT5C (5'(3')-deoxyribonucleotidase, Cytosolic Type, Cytosolic 5',3'-pyrimidine Nucleotidase, Deoxy-5'-nucleotidase 1, dNT-1, DNT1, UMPH2, DNT, DNT-1, P5N2, PN-I, PN-II) (Biotin)

Gene Names
NT5C; DNT; cdN; DNT1; P5N2; PN-I; HEL74; PN-II; UMPH2; dNT-1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NT5C; Polyclonal Antibody; NT5C (5'(3')-deoxyribonucleotidase; Cytosolic Type; Cytosolic 5'; 3'-pyrimidine Nucleotidase; Deoxy-5'-nucleotidase 1; dNT-1; DNT1; UMPH2; DNT; DNT-1; P5N2; PN-I; PN-II) (Biotin); anti-NT5C antibody
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human NT5C.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
994
Applicable Applications for anti-NT5C antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human NT5C, aa1-117 (AAH08183.1).
Immunogen Sequence
MARSVRVLVDMDGVLADFEAGLLRGFRRRFPEEPHVPLEQRRGFLAREQYRALRPDLADKVASVYEAPGFFLDLEPIPGALDAVREMNDLPDPLLKYHHCVGEKVWLPRPYSARGAA
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of NT5C expression in transfected 293T cell line by NT5C polyclonal antibody. Lane 1: NT5C transfected lysate (13.3kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-NT5C antibody
Dephosphorylates the 5' and 2'(3')-phosphates of deoxyribonucleotides, with a preference for dUMP and dTMP, intermediate activity towards dGMP, and low activity towards dCMP and dAMP.
Product Categories/Family for anti-NT5C antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens 5', 3'-nucleotidase, cytosolic, mRNA
NCBI Official Synonym Full Names
5', 3'-nucleotidase, cytosolic
NCBI Official Symbol
NT5C
NCBI Official Synonym Symbols
DNT; cdN; DNT1; P5N2; PN-I; HEL74; PN-II; UMPH2; dNT-1
NCBI Protein Information
5'(3')-deoxyribonucleotidase, cytosolic type

NCBI Description

This gene encodes a nucleotidase that catalyzes the dephosphorylation of the 5' deoxyribonucleotides (dNTP) and 2'(3')-dNTP and ribonucleotides, but not 5' ribonucleotides. Of the different forms of nucleotidases characterized, this enzyme is unique in its preference for 5'-dNTP. It may be one of the enzymes involved in regulating the size of dNTP pools in cells. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Nov 2011]

Research Articles on NT5C

Similar Products

Product Notes

The NT5C (Catalog #AAA6387647) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NT5C (5'(3')-deoxyribonucleotidase, Cytosolic Type, Cytosolic 5',3'-pyrimidine Nucleotidase, Deoxy-5'-nucleotidase 1, dNT-1, DNT1, UMPH2, DNT, DNT-1, P5N2, PN-I, PN-II) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NT5C can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NT5C for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NT5C, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual