Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human MYL5 Polyclonal Antibody | anti-MYL5 antibody

MYL5 (Myosin Light Chain 5, Myosin Regulatory Light Chain 5, Superfast Myosin Regulatory Light Chain 2, MYLC2, MyLC-2) (MaxLight 550)

Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MYL5; Polyclonal Antibody; MYL5 (Myosin Light Chain 5; Myosin Regulatory Light Chain 5; Superfast Myosin Regulatory Light Chain 2; MYLC2; MyLC-2) (MaxLight 550); anti-MYL5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human MYL5.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-MYL5 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human MYL5, aa1-173 (NP_002468.1).
Immunogen Sequence
MASRKTKKKEGGALRAQRASSNVFSNFEQTQIQEFKEAFTLMDQNRDGFIDKEDLKDTYASLGKTNVKDDELDAMLKEASGPINFTMFLNLFGEKLSGTDAEETILNAFKMLDPDGKGKINKEYIKRLLMSQADKMTAEEVDQMFQFASIDVAGNLDYKALSYVITHGEEKEE
Conjugate
MaxLight550
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-MYL5 antibody
Myosin regulatory light chain 5, also known as MYL5, is a hexameric ATPase cellular motor protein. Myosin is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. MYL5 is a regulatory light chain and is expressed in fetal muscle and in adult retina, cerebellum, and basal ganglia. Reconstitution of myosin with regulatory light chain 5 or alkali light chain increases filament velocity to intermediate rates, and readdition of both classes of light chains fully restores the original sliding velocity.
Product Categories/Family for anti-MYL5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14,888 Da
NCBI Official Full Name
myosin light chain 5
NCBI Official Synonym Full Names
myosin, light chain 5, regulatory
NCBI Official Symbol
MYL5
NCBI Protein Information
myosin light chain 5; MYLC2; myLC-2; myosin regulatory light chain 5; myosin, light polypeptide 5, regulatory; superfast myosin regulatory light chain 2
UniProt Protein Name
Myosin light chain 5
Protein Family
UniProt Gene Name
MYL5
UniProt Synonym Gene Names
MYLC2; MyLC-2
UniProt Entry Name
MYL5_HUMAN

NCBI Description

This gene encodes one of the myosin light chains, a component of the hexameric ATPase cellular motor protein myosin. Myosin is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene product, one of the regulatory light chains, is expressed in fetal muscle and in adult retina, cerebellum, and basal ganglia. [provided by RefSeq, Jul 2008]

Uniprot Description

MYL5: 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Contractile; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 4p16.3

Cellular Component: muscle myosin complex

Molecular Function: structural constituent of muscle; calcium ion binding

Biological Process: regulation of muscle contraction

Research Articles on MYL5

Similar Products

Product Notes

The MYL5 myl5 (Catalog #AAA6386288) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MYL5 (Myosin Light Chain 5, Myosin Regulatory Light Chain 5, Superfast Myosin Regulatory Light Chain 2, MYLC2, MyLC-2) (MaxLight 550) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MYL5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MYL5 myl5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MYL5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.