Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (MOS rabbit polyclonal antibody. Western Blot analysis of MOS expression in human pancreas.)

Rabbit anti-Human MOS Polyclonal Antibody | anti-MOS antibody

MOS (Proto-oncogene Serine/Threonine-protein Kinase Mos, Oocyte Maturation Factor Mos, Proto-oncogene c-Mos, MGC119962, MGC119963) APC

Gene Names
MOS; MSV
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MOS; Polyclonal Antibody; MOS (Proto-oncogene Serine/Threonine-protein Kinase Mos; Oocyte Maturation Factor Mos; Proto-oncogene c-Mos; MGC119962; MGC119963) APC; anti-MOS antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human MOS.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-MOS antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human MOS, aa1-346 (NP_005363.1).
Immunogen Sequence
MPSPLALRPYLRSEFSPSVDARPCSSPSELPAKLLLGATLPRAPRLPRRLAWCSIDWEQVCLLQRLGAGGFGSVYKATYRGVPVAIKQVNKCTKNRLASRRSFWAELNVARLRHDNIVRVVAASTRTPAGSNSLGTIIMEFGGNVTLHQVIYGAAGHPEGDAGEPHCRTGGQLSLGKCLKYSLDVVNGLLFLHSQSIVHLDLKPANILISEQDVCKISDFGCSEKLEDLLCFQTPSYPLGGTYTHRAPELLKGEGVTPKADIYSFAITLWQMTTKQAPYSGERQHILYAVVAYDLRPSLSAAVFEDSLPGQRLGDVIQRCWRPSAAQRPSARLLLVDLTSLKAELG
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(MOS rabbit polyclonal antibody. Western Blot analysis of MOS expression in human pancreas.)

Western Blot (WB) (MOS rabbit polyclonal antibody. Western Blot analysis of MOS expression in human pancreas.)

Western Blot (WB)

(Western Blot analysis of MOS expression in transfected 293T cell line by MOS polyclonal antibody. Lane 1: MOS transfected lysate (37.8kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of MOS expression in transfected 293T cell line by MOS polyclonal antibody. Lane 1: MOS transfected lysate (37.8kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-MOS antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37,820 Da
NCBI Official Full Name
proto-oncogene serine/threonine-protein kinase mos
NCBI Official Synonym Full Names
v-mos Moloney murine sarcoma viral oncogene homolog
NCBI Official Symbol
MOS
NCBI Official Synonym Symbols
MSV
NCBI Protein Information
proto-oncogene serine/threonine-protein kinase mos; c-mos; proto-oncogene c-Mos; oocyte maturation factor mos; oncogene MOS, Moloney murine sarcoma virus
UniProt Protein Name
Proto-oncogene serine/threonine-protein kinase mos
UniProt Gene Name
MOS
UniProt Entry Name
MOS_HUMAN

NCBI Description

MOS is a serine/threonine kinase that activates the MAP kinase cascade through direct phosphorylation of the MAP kinase activator MEK (MAP2K1; MIM 176872) (Prasad et al., 2008 [PubMed 18246541]).[supplied by OMIM, Jul 2009]

Uniprot Description

MOS: a proto-oncogenic serine/threonine kinase of the MOS family. Expressed predominantly in germ cells. Crucial for normal oocyte meiosis and female fertility in mice.

Protein type: Protein kinase, Other; Kinase, protein; EC 2.7.11.1; Oncoprotein; Protein kinase, Ser/Thr (non-receptor); Other group; MOS family

Chromosomal Location of Human Ortholog: 8q11

Cellular Component: cytoplasm

Molecular Function: protein serine/threonine kinase activity; MAP kinase kinase kinase activity; ATP binding

Biological Process: establishment of meiotic spindle orientation; establishment and/or maintenance of chromatin architecture; activation of MAPKK activity; activation of MAPK activity; protein amino acid autophosphorylation; regulation of meiosis; MAPKKK cascade; meiotic spindle organization and biogenesis

Research Articles on MOS

Similar Products

Product Notes

The MOS mos (Catalog #AAA6385765) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MOS (Proto-oncogene Serine/Threonine-protein Kinase Mos, Oocyte Maturation Factor Mos, Proto-oncogene c-Mos, MGC119962, MGC119963) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MOS can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MOS mos for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MOS, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.