Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of MAPKAPK5 expression in transfected 293T cell line by MAPKAPK5 polyclonal antibody. Lane 1: MAPKAPK5 transfected lysate (54kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human MAPKAPK5 Polyclonal Antibody | anti-MAPKAPK5 antibody

MAPKAPK5 (Mitogen-activated Protein Kinase-activated Protein Kinase 5, MAP Kinase-activated Protein Kinase 5, MAPK-activated Protein Kinase 5, MAPKAP Kinase 5, MAPKAPK-5, p38-regulated/activated Protein Kinase, PRAK) (FITC)

Gene Names
MAPKAPK5; MK5; MK-5; PRAK; MAPKAP-K5
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MAPKAPK5; Polyclonal Antibody; MAPKAPK5 (Mitogen-activated Protein Kinase-activated Protein Kinase 5; MAP Kinase-activated Protein Kinase 5; MAPK-activated Protein Kinase 5; MAPKAP Kinase 5; MAPKAPK-5; p38-regulated/activated Protein Kinase; PRAK) (FITC); anti-MAPKAPK5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human MAPKAPK5.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
Applicable Applications for anti-MAPKAPK5 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human MAPKAPK5, aa1-471 (NP_003659.2)
Immunogen Sequence
MSEESDMDKAIKETSILEEYSINWTQKLGAGISGPVRVCVKKSTQERFALKILLDRPKARNEVRLHMMCATHPNIVQIIEVFANSVQFPHESSPRARLLIVMEMMEGGELFHRISQHRHFTEKQASQVTKQIALALRHCHLLNIAHRDLKPENLLFKDNSLDAPVKLCDFGFAKIDQGDLMTPQFTPYYVAPQVLEAQRRHQKEKSGIIPTSPTPYTYNKSCDLWSLGVIIYVMLCGYPPFYSKHHSRTIPKDMRRKIMTGSFEFPEEEWSQISEMAKDVVRKLLKVKPEERLTIEGVLDHPWLNSTEALDNVLPSAQLMMDKAVVAGIQQAHAEQLANMRIQDLKVSLKPLHSVNNPILRKRKLLGTKPKDSVYIHDHENGAEDSNVALEKLRDVIAQCILPQAGENEDEKLNEVMQEAWKYNRECKLLRDTLQSFSWNGRGFTDKVDRLKLAEIVKQVIEEQTTSHESQ
Conjugate
FITC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of MAPKAPK5 expression in transfected 293T cell line by MAPKAPK5 polyclonal antibody. Lane 1: MAPKAPK5 transfected lysate (54kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of MAPKAPK5 expression in transfected 293T cell line by MAPKAPK5 polyclonal antibody. Lane 1: MAPKAPK5 transfected lysate (54kD). Lane 2: Non-transfected lysate.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between MAPKAPK5 and EIF4EBP1. HeLa cells were stained with MAPKAPK5 rabbit purified polyclonal 1:1200 and EIF4EBP1 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between MAPKAPK5 and EIF4EBP1. HeLa cells were stained with MAPKAPK5 rabbit purified polyclonal 1:1200 and EIF4EBP1 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Related Product Information for anti-MAPKAPK5 antibody
MAPKAPK5 is a member of the serine/threonine kinase family. In response to cellular stress and proinflammatory cytokines, this kinase is activated through its phosphorylation by MAP kinases including MAPK1/ERK, MAPK14/p38-alpha, and MAPK11/p38-beta. In vitro, this kinase phosphorylates heat shock protein HSP27 at its physiologically relevant sites.
Product Categories/Family for anti-MAPKAPK5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
MAP kinase-activated protein kinase 5 isoform 1
NCBI Official Synonym Full Names
mitogen-activated protein kinase-activated protein kinase 5
NCBI Official Symbol
MAPKAPK5
NCBI Official Synonym Symbols
MK5; MK-5; PRAK; MAPKAP-K5
NCBI Protein Information
MAP kinase-activated protein kinase 5; MAPKAPK-5; MAPKAP kinase 5; MAPK-activated protein kinase 5; p38-regulated/activated protein kinase
UniProt Protein Name
MAP kinase-activated protein kinase 5
UniProt Gene Name
MAPKAPK5
UniProt Synonym Gene Names
PRAK; MAPK-activated protein kinase 5; MAPKAP kinase 5; MAPKAP-K5; MAPKAPK-5; MK-5; MK5; PRAK
UniProt Entry Name
MAPK5_HUMAN

NCBI Description

The protein encoded by this gene is a tumor suppressor and member of the serine/threonine kinase family. In response to cellular stress and proinflammatory cytokines, this kinase is activated through its phosphorylation by MAP kinases including MAPK1/ERK, MAPK14/p38-alpha, and MAPK11/p38-beta. The encoded protein is found in the nucleus but translocates to the cytoplasm upon phosphorylation and activation. This kinase phosphorylates heat shock protein HSP27 at its physiologically relevant sites. Two alternately spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq, Nov 2012]

Uniprot Description

MAPKAPK5: a member of the MAPKAPK family of protein kinases. Activated through phosphorylation by MAP kinases including ERK, p38-alpha, and MAPp38-beta In response to cellular stress and proinflammatory cytokines. Two alternately spliced transcript variants of this gene encoding distinct isoforms have been reported.

Protein type: Protein kinase, CAMK; EC 2.7.11.1; Tumor suppressor; Kinase, protein; Protein kinase, Ser/Thr (non-receptor); CAMK group; MAPKAPK family; MAPKAPK subfamily

Chromosomal Location of Human Ortholog: 12q24.13

Cellular Component: nucleoplasm; cytoplasm

Molecular Function: MAP kinase kinase activity; protein serine/threonine kinase activity; protein binding; p53 binding; mitogen-activated protein kinase binding; ATP binding

Biological Process: regulation of translation; negative regulation of TOR signaling pathway; activation of MAPK activity; protein amino acid autophosphorylation; Ras protein signal transduction; MAPKKK cascade; signal transduction

Research Articles on MAPKAPK5

Similar Products

Product Notes

The MAPKAPK5 mapkapk5 (Catalog #AAA6384942) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MAPKAPK5 (Mitogen-activated Protein Kinase-activated Protein Kinase 5, MAP Kinase-activated Protein Kinase 5, MAPK-activated Protein Kinase 5, MAPKAP Kinase 5, MAPKAPK-5, p38-regulated/activated Protein Kinase, PRAK) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MAPKAPK5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MAPKAPK5 mapkapk5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MAPKAPK5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.