Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of LAG3 expression in transfected 293T cell line by LAG3 polyclonal antibody. Lane 1: LAG3 transfected lysate (39.1kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human LAG3 Polyclonal Antibody | anti-LAG3 antibody

LAG3 (Lymphocyte Activation Gene 3 Protein, LAG-3, Protein FDC, CD223, FDC) (FITC)

Gene Names
LAG3; CD223
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
LAG3; Polyclonal Antibody; LAG3 (Lymphocyte Activation Gene 3 Protein; LAG-3; Protein FDC; CD223; FDC) (FITC); anti-LAG3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human LAG3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
Sequence Length
1595
Applicable Applications for anti-LAG3 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human LAG3, aa1-360 (AAH52589.1).
Immunogen Sequence
MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITGQPQVGKE
Conjugate
FITC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of LAG3 expression in transfected 293T cell line by LAG3 polyclonal antibody. Lane 1: LAG3 transfected lysate (39.1kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of LAG3 expression in transfected 293T cell line by LAG3 polyclonal antibody. Lane 1: LAG3 transfected lysate (39.1kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-LAG3 antibody
LAG-3 is a member of the immunoglobulin superfamily (IgSF). The mature LAG-3 protein is a 496aa membrane protein with a 421aa extracellular region which contains four IgSF domains, a 21aa transmembrane region and a 54aa cytoplasmic region. LAG-3 shares <20% aa sequence homology with CD4, but has similar structure and binds to MHC class II with higher affinity. The mouse LAG-3 extracellular region shares 69% aa sequence identity with human LAG-3.
Product Categories/Family for anti-LAG3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens lymphocyte-activation gene 3, mRNA
NCBI Official Synonym Full Names
lymphocyte activating 3
NCBI Official Symbol
LAG3
NCBI Official Synonym Symbols
CD223
NCBI Protein Information
lymphocyte activation gene 3 protein

NCBI Description

Lymphocyte-activation protein 3 belongs to Ig superfamily and contains 4 extracellular Ig-like domains. The LAG3 gene contains 8 exons. The sequence data, exon/intron organization, and chromosomal localization all indicate a close relationship of LAG3 to CD4. [provided by RefSeq, Jul 2008]

Research Articles on LAG3

Similar Products

Product Notes

The LAG3 (Catalog #AAA6384018) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LAG3 (Lymphocyte Activation Gene 3 Protein, LAG-3, Protein FDC, CD223, FDC) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LAG3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the LAG3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LAG3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.