Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human KLRG1 Polyclonal Antibody | anti-KLRG1 antibody

KLRG1 (Killer Cell Lectin-like Receptor Subfamily G Member 1, 2F1-Ag, Mast Cell Function-associated Antigen 2F1, MAFA, MAFA-L, MGC123930) (MaxLight 490)

Gene Names
KLRG1; 2F1; MAFA; MAFA-L; CLEC15A; MAFA-2F1; MAFA-LIKE
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
KLRG1; Polyclonal Antibody; KLRG1 (Killer Cell Lectin-like Receptor Subfamily G Member 1; 2F1-Ag; Mast Cell Function-associated Antigen 2F1; MAFA; MAFA-L; MGC123930) (MaxLight 490); anti-KLRG1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human KLRG1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Sequence Length
1874
Applicable Applications for anti-KLRG1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full-length human KLRG1, aa1-207 (NP_005801.3).
Immunogen Sequence
MTDSVIYSMLELPTATQAQNDYGPQQKSSSSRPSCSCLVAIALGLLTAVLLSVLLYQWILCQGSNYSTCASCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMSLLQVFLSEAFCWIGLRNNSGWRWEDGSPLNFSRISSNSFVQTCGAINKNGLQASSCEVPLHWVCKKVRL
Conjugate
MaxLight490
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-KLRG1 antibody
KLRG1 (killer cell lectin-like receptor G1), is the mouse homolog of the rat mast cell function-associated antigen (MAFA). It is expressed by activated CD8 T-cells and by a large proportion of natural killer (NK) cells. It is not found in the spleen, thymus, lymph nodes, testis, brain or kidney and is not expressed on mast cell lines, bone-marrow-derived mast cells or peritoneal mast cells. T-cells expressing KLRG1 have greatly reduced proliferation potential, but are not limited in their capacity to perform immediate effector cell functions, such as the secretion of gamma interferon. KLRG1 plays an inhibitory role on NK cells and T-cells by binding to their ligands.
Product Categories/Family for anti-KLRG1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens killer cell lectin like receptor G1 (KLRG1), transcript variant 2, mRNA
NCBI Official Synonym Full Names
killer cell lectin like receptor G1
NCBI Official Symbol
KLRG1
NCBI Official Synonym Symbols
2F1; MAFA; MAFA-L; CLEC15A; MAFA-2F1; MAFA-LIKE
NCBI Protein Information
killer cell lectin-like receptor subfamily G member 1
UniProt Protein Name
Killer cell lectin-like receptor subfamily G member 1
UniProt Gene Name
KLRG1
UniProt Synonym Gene Names
CLEC15A; MAFA; MAFAL
UniProt Entry Name
KLRG1_HUMAN

NCBI Description

Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. The protein encoded by this gene belongs to the killer cell lectin-like receptor (KLR) family, which is a group of transmembrane proteins preferentially expressed in NK cells. Studies in mice suggested that the expression of this gene may be regulated by MHC class I molecules. [provided by RefSeq, Jun 2016]

Uniprot Description

KLRG1: Plays an inhibitory role on natural killer (NK) cells and T-cell functions upon binding to their non-MHC ligands. May mediate missing self recognition by binding to a highly conserved site on classical cadherins, enabling it to monitor expression of E-cadherin/CDH1, N-cadherin/CDH2 and R-cadherin/CDH4 on target cells. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 12p13.31

Cellular Component: plasma membrane; integral to membrane

Molecular Function: receptor activity; carbohydrate binding

Biological Process: regulation of immune response; cell surface receptor linked signal transduction; cellular defense response; innate immune response; inflammatory response

Research Articles on KLRG1

Similar Products

Product Notes

The KLRG1 klrg1 (Catalog #AAA6383768) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KLRG1 (Killer Cell Lectin-like Receptor Subfamily G Member 1, 2F1-Ag, Mast Cell Function-associated Antigen 2F1, MAFA, MAFA-L, MGC123930) (MaxLight 490) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KLRG1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the KLRG1 klrg1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KLRG1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.