Rabbit anti-Human KLRG1 Polyclonal Antibody | anti-KLRG1 antibody

KLRG1 (Killer Cell Lectin-like Receptor Subfamily G Member 1, 2F1-Ag, Mast Cell Function-associated Antigen 2F1, MAFA, MAFA-L, MGC123930) (HRP)

Cat. Num. AAA6383766

• Gene Names: KLRG1; 2F1; MAFA; MAFA-L; CLEC15A; MAFA-2F1; MAFA-LIKE
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: KLRG1; Polyclonal Antibody; KLRG1 (Killer Cell Lectin-like Receptor Subfamily G Member 1; 2F1-Ag; Mast Cell Function-associated Antigen 2F1; MAFA; MAFA-L; MGC123930) (HRP); anti-KLRG1 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human KLRG1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).
• Sequence Length: 1874

• Applicable Applications for anti-KLRG1 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full-length human KLRG1, aa1-207 (NP_005801.3).
• Immunogen Sequence: MTDSVIYSMLELPTATQAQNDYGPQQKSSSSRPSCSCLVAIALGLLTAVLLSVLLYQWILCQGSNYSTCASCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMSLLQVFLSEAFCWIGLRNNSGWRWEDGSPLNFSRISSNSFVQTCGAINKNGLQASSCEVPLHWVCKKVRL
• Conjugate: HRP
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of KLRG1 expression in transfected 293T cell line by KLRG1 polyclonal antibody. Lane 1: KLRG1 transfected lysate (21.2kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-KLRG1 antibody

KLRG1 (killer cell lectin-like receptor G1), is the mouse homolog of the rat mast cell function-associated antigen (MAFA). It is expressed by activated CD8 T-cells and by a large proportion of natural killer (NK) cells. It is not found in the spleen, thymus, lymph nodes, testis, brain or kidney and is not expressed on mast cell lines, bone-marrow-derived mast cells or peritoneal mast cells. T-cells expressing KLRG1 have greatly reduced proliferation potential, but are not limited in their capacity to perform immediate effector cell functions, such as the secretion of gamma interferon. KLRG1 plays an inhibitory role on NK cells and T-cells by binding to their ligands.

Product Categories/Family for anti-KLRG1 antibody

Antibodies; Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 1519314194
• NCBI GeneID: 10219
• NCBI Accession #: NM_005810.4
• NCBI GenBank Nucleotide #: NM_005810
• UniProt Accession #: Q96E93
• NCBI Official Full Name: Homo sapiens killer cell lectin like receptor G1 (KLRG1), transcript variant 2, mRNA
• NCBI Official Synonym Full Names: killer cell lectin like receptor G1
• NCBI Official Symbol: KLRG1
• NCBI Official Synonym Symbols: 2F1; MAFA; MAFA-L; CLEC15A; MAFA-2F1; MAFA-LIKE
• NCBI Protein Information: killer cell lectin-like receptor subfamily G member 1
• UniProt Protein Name: Killer cell lectin-like receptor subfamily G member 1
• Protein Family: Killer cell lectin-like receptor subfamily
• UniProt Gene Name: KLRG1
• UniProt Synonym Gene Names: CLEC15A; MAFA; MAFAL
• UniProt Entry Name: KLRG1_HUMAN

NCBI Description

Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. The protein encoded by this gene belongs to the killer cell lectin-like receptor (KLR) family, which is a group of transmembrane proteins preferentially expressed in NK cells. Studies in mice suggested that the expression of this gene may be regulated by MHC class I molecules. [provided by RefSeq, Jun 2016]

Uniprot Description

KLRG1: Plays an inhibitory role on natural killer (NK) cells and T-cell functions upon binding to their non-MHC ligands. May mediate missing self recognition by binding to a highly conserved site on classical cadherins, enabling it to monitor expression of E-cadherin/CDH1, N-cadherin/CDH2 and R-cadherin/CDH4 on target cells. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 12p13.31

Cellular Component: plasma membrane; integral to membrane

Molecular Function: receptor activity; carbohydrate binding

Biological Process: regulation of immune response; cell surface receptor linked signal transduction; cellular defense response; innate immune response; inflammatory response