Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Rabbit anti-Human, Mouse KLF16 Polyclonal Antibody | anti-KLF16 antibody

KLF16 (Kruppel-like Factor 16, Basic Transcription Element Binding Protein 4, BTE-binding Protein 4, BTEB4, DRRF, Novel Sp1-like Zinc Finger Transcription Factor 2, NSLP2, Transcription Factor BTEB4, Transcription Factor NSLP2) (PE)

Gene Names
KLF16; DRRF; BTEB4; NSLP2
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
KLF16; Polyclonal Antibody; KLF16 (Kruppel-like Factor 16; Basic Transcription Element Binding Protein 4; BTE-binding Protein 4; BTEB4; DRRF; Novel Sp1-like Zinc Finger Transcription Factor 2; NSLP2; Transcription Factor BTEB4; Transcription Factor NSLP2) (PE); anti-KLF16 antibody
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human KLF16. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
820
Applicable Applications for anti-KLF16 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human KLF16, aa1-252 (AAI48794.1).
Immunogen Sequence
MSAAVACVDYFAADVLMAISSGAVVHRGRPGPEGAGPAAGLDVRAARREAASPGTPGPPPPPPAASGPGPGAAAAPHLLAASILADLRGGPGAAPGGASPASSSSAASSPSSGRAPGAAPSAAAKSHRCPFPDCAKAYYKSSHLKSHLRTHTGERPFACDWQGCDKKFARSDELARHHRTHTGEKRFSCPLCSKRFTRSDHLAKHARRHPGFHPDLLRRPGARSTSPSDSLPCSLAGSPAPSPAPSPAPAGL
Conjugate
PE
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(KLF16 rabbit polyclonal antibody. Western Blot analysis of KLF16 expression in mouse kidney.)

Western Blot (WB)

(Western Blot analysis of KLF16 expression in transfected 293T cell line by KLF16 polyclonal antibody. Lane 1: KLF16 transfected lysate (27.72kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-KLF16 antibody
KLF16 is a nuclear zinc finger transcription factor highly expressed in brain regions with abundant dopaminergic terminals, that binds GC and GT boxes and displaces Sp1 and Sp3 from these sequences. KLF16 modulates dopaminergic transmission in the brain.
Product Categories/Family for anti-KLF16 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Synthetic construct Homo sapiens clone IMAGE:100015888, MGC:183206 Kruppel-like factor 16 (KLF16) mRNA, encodes complete protein
NCBI Official Synonym Full Names
Kruppel like factor 16
NCBI Official Symbol
KLF16
NCBI Official Synonym Symbols
DRRF; BTEB4; NSLP2
NCBI Protein Information
Krueppel-like factor 16
Protein Family

Research Articles on KLF16

Similar Products

Product Notes

The KLF16 (Catalog #AAA6383673) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KLF16 (Kruppel-like Factor 16, Basic Transcription Element Binding Protein 4, BTE-binding Protein 4, BTEB4, DRRF, Novel Sp1-like Zinc Finger Transcription Factor 2, NSLP2, Transcription Factor BTEB4, Transcription Factor NSLP2) (PE) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's KLF16 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the KLF16 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KLF16, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual