Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human Interleukin 24 Polyclonal Antibody | anti-IL-24 antibody

Interleukin 24 (Interleukin-24, IL-24, IL24, Melanoma Differentiation-associated Gene 7 Protein, MDA-7, Suppression of Tumorigenicity 16 Protein, MDA7, ST16) (MaxLight 405)

Gene Names
IL24; C49A; FISP; MDA7; MOB5; ST16; IL10B
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Interleukin 24; Polyclonal Antibody; Interleukin 24 (Interleukin-24; IL-24; IL24; Melanoma Differentiation-associated Gene 7 Protein; MDA-7; Suppression of Tumorigenicity 16 Protein; MDA7; ST16) (MaxLight 405); anti-IL-24 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human IL24.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-IL-24 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human IL24, aa1-206 (NP_006841.1).
Immunogen Sequence
MNFQQRLQSLWTLARPFCPPLLATASQMQMVVLPCLGFTLLLWSQVSGAQGQEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQLDVEAALTKALGEVDILLTWMQKFYKL
Conjugate
MaxLight405
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-IL-24 antibody
Interleukin 24 (IL-24), also known as mda-7 (melanoma differentiation associated gene-7), is a newly discovered member of the IL-10 family of helical cytokines. The IL-24 gene encodes a precursor protein of 207 amino acids (aa) that contains a 48 aa signal sequence and an 18kD, 158 aa mature segment. There are three potential N-linked glycosylation sites, at least one of which is used. When secreted, IL-24 is a 35-40kD phosphorylated glycoprotein that apparently can exist as either a monomer or dimer. It is suggested that glycosylation is essential for activity. Mature human IL-24 shares 69% aa sequence identity with mouse and rat IL-24. Human IL-24 is active in rodent systems. Cells known to express IL-24 include B cells, CD4+ T cells, NK cells, lymph node dendritic cells, monocytes, melanocytes, and melanoma cells. Functionally, IL-24 has diverse activities. At low concentrations on monocytes, it induces type I proinflammatory cytokines such as IFN-gamma, IL-1Beta, IL-12 and TNF-alpha. At high concentrations, it is a strong inducer of apoptosis in tumor cells, but not in normal cells. IL-24 also has anti-angiogenic properties. It binds directly to IL-24 receptors on endothelial cells, activating STAT3 and blocking their differentiation. IL-24 binds and signals through two heterodimeric receptor complexes. One complex is the combination of IL-20 Ralpha. and IL-20 RBeta, which is shared with IL-19 and IL-20. The second complex is a combination of IL-22 R and IL-20 RBeta, which is shared with IL-20.
Product Categories/Family for anti-IL-24 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
7,347 Da
NCBI Official Full Name
interleukin-24 isoform 1
NCBI Official Synonym Full Names
interleukin 24
NCBI Official Symbol
IL24
NCBI Official Synonym Symbols
C49A; FISP; MDA7; MOB5; ST16; IL10B
NCBI Protein Information
interleukin-24; melanocyte-associated Mda-7; IL-4-induced secreted protein; melanoma differentiation-associated gene 7 protein; suppression of tumorigenicity 16 (melanoma differentiation)
UniProt Protein Name
Interleukin-24
UniProt Gene Name
IL24
UniProt Synonym Gene Names
MDA7; ST16; IL-24; MDA-7
UniProt Entry Name
IL24_HUMAN

NCBI Description

This gene encodes a member of the IL10 family of cytokines. It was identified as a gene induced during terminal differentiation in melanoma cells. The protein encoded by this gene can induce apoptosis selectively in various cancer cells. Overexpression of this gene leads to elevated expression of several GADD family genes, which correlates with the induction of apoptosis. The phosphorylation of mitogen-activated protein kinase 14 (MAPK7/P38), and heat shock 27kDa protein 1 (HSPB2/HSP27) are found to be induced by this gene in melanoma cells, but not in normal immortal melanocytes. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]

Uniprot Description

IL24: Has antiproliferative properties on melanoma cells and may contribute to terminal cell differentiation. Belongs to the IL-10 family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 1q32

Cellular Component: extracellular space; endoplasmic reticulum

Molecular Function: cytokine activity

Biological Process: negative regulation of cell proliferation; wound healing; apoptosis; positive regulation of cell proliferation; positive regulation of JAK-STAT cascade; positive regulation of caspase activity; immune response; negative regulation of caspase activity; inflammatory response; negative regulation of cell migration; positive regulation of tyrosine phosphorylation of Stat3 protein; serine phosphorylation of STAT3 protein

Research Articles on IL-24

Similar Products

Product Notes

The IL-24 il24 (Catalog #AAA6382997) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Interleukin 24 (Interleukin-24, IL-24, IL24, Melanoma Differentiation-associated Gene 7 Protein, MDA-7, Suppression of Tumorigenicity 16 Protein, MDA7, ST16) (MaxLight 405) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Interleukin 24 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the IL-24 il24 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Interleukin 24, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.